SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000002730 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000002730
Domain Number 1 Region: 314-490
Classification Level Classification E-value
Superfamily Kelch motif 3.4e-52
Family Kelch motif 0.000023
Further Details:      
 
Domain Number 2 Region: 446-596
Classification Level Classification E-value
Superfamily Kelch motif 1.44e-40
Family Kelch motif 0.0000817
Further Details:      
 
Domain Number 3 Region: 41-158
Classification Level Classification E-value
Superfamily POZ domain 1.41e-30
Family BTB/POZ domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000002730   Gene: ENSGMOG00000002584   Transcript: ENSGMOT00000002817
Sequence length 617
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_4501:58269:67504:-1 gene:ENSGMOG00000002584 transcript:ENSGMOT00000002817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPGDVVPEHAKQPKQPKPKEKRPGSKALKAECDADGSFVFEAHEAWKDFHNSLRHFYEV
GELCDVTLKVGSRLIPCHKLVLACVIPYFRAMFLSEMAEAKQELIEIKDFDGDAIHDLVH
FAYSSRLILTVDNVQPLLYAACILQVELVARACCEYMKAHFHPTNCLAVRTFAESHNRVD
LMDMADRYACEHFCAVVECEDFPCVSPQHLRTLLSSGELNIHAEAQVYSAAVKWLAANPQ
HHEAWLDQILSQVRLPLLPVDFLTGTVAKEEMIKGNLSCRDLLDEARNYHLHLSNKVVPD
FEYSVRTTPRKHTAGVLFCVGGRGGSGDPFRSIECYSITKNSWFFGPEMNSRRRHVGVIS
VGGKVYAVGGHDGSEHLGNMEMFDPLTNKWMMMASMNTKRRGIALAALGGPIYAIGGLDD
NSCFNDVERYDIESDRWSAVAPMNTPRGGVGSVALGSHVYAVGGNDGVASLSSVERFDPH
LNKWTEVTEMGQRRAGNGVSKLNGCLYVVGGFDDNSPLSSVERFDPRSNDWEYVSELTTP
RGGVGVSTVMGRVFAVGGHNGNIYLNTVEAFEPRMNRWELVGSVSHCRAGAGVAVCLSHI
SQIRDVGLGSSNVVNCM
Download sequence
Identical sequences ENSGMOP00000002730 ENSGMOP00000002730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]