SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000002861 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000002861
Domain Number 1 Region: 290-576
Classification Level Classification E-value
Superfamily Kelch motif 2.88e-64
Family Kelch motif 0.0000743
Further Details:      
 
Domain Number 2 Region: 12-131
Classification Level Classification E-value
Superfamily POZ domain 4.71e-31
Family BTB/POZ domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000002861   Gene: ENSGMOG00000002660   Transcript: ENSGMOT00000002952
Sequence length 589
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1396:77973:80551:-1 gene:ENSGMOG00000002660 transcript:ENSGMOT00000002952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FRMDLAAIEVFHYQDKELSSALLLQLNSLRRDRVFTDVFLCSDQSEIPCHRNVLVSSSPY
FRAMFCSNFMETNQTRIRITGITSSSLSSIIDYVYTGLISITMENVLPLMQAASMLQYGR
LFEVCSAFLQERLSPENCLSMIRLSEILSCNSLKNKAKAMAMESFSDVSSSEDLCELSLP
ELLGYLEDDTLCADEEQVFETLVAWIHHDPRARRGAISDLFKKVRLRFIHPTYLFQFIAN
DPLIQSSTLCTEIIESVRRLMFSVNSKSPSDTAVNLKPLWVAPRRYTCSETLVVVGGRKN
NEQTSREALIFDENSQTWQWLAKLPLRLYKASYVCLHSVLYVLGGLPTTATNTPRQASSA
VYTLSLKTNQWRTAEPMLAPHFAHQSISFLHFIFVLGGLGSDRCVSNSVERYNSMFNQWE
TMSPMPEAVLHPAVAAADQRIYVFGGENAMQNPVRMIQVYHISRNLWFKMENRTVKNISA
PAAVIDDKIYIVGGYTRRVMAYDTKTNRFTNCANLKERRMHHAVTVLNHKLYITGGRYVT
GHDLIEDSDSVECYDPATDSWTSKGTLPYKLFDHGSMALTCVTQTLAKS
Download sequence
Identical sequences ENSGMOP00000002861 ENSGMOP00000002861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]