SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000002882 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000002882
Domain Number 1 Region: 280-570
Classification Level Classification E-value
Superfamily Kelch motif 5.89e-59
Family Kelch motif 0.0001
Further Details:      
 
Domain Number 2 Region: 4-121
Classification Level Classification E-value
Superfamily POZ domain 7.85e-32
Family BTB/POZ domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000002882   Gene: ENSGMOG00000002660   Transcript: ENSGMOT00000002973
Sequence length 580
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1396:77985:80712:-1 gene:ENSGMOG00000002660 transcript:ENSGMOT00000002973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HKLSPPGHPSPLLLQLNSLRRDRVFTDVFLCSDQSEIPCHRNVLVSSSPYFRAMFCSNFM
ETNQTRIRITGITSSSLSSIIDYVYTGLISITMENVLPLMQAASMLQYGRLFEVCSAFLQ
ERLSPENCLSMIRLSEILSCNSLKNKAKAMAMESFSDVSSSEDLCELSLPELLGYLEDDT
LCADEEQVFETLVAWIHHDPRARRGAISDLFKKVRLRFIHPTYLFQFIANDPLIQSSTLC
TEIIESVRRLMFSVNSKSPSDTAVNLKPLWVAPRRYTCSETLVVVGGRKNNEQTSREALI
FDENSQTWQWLAKLPLRLYKASYVCLHSVLYVLGGLPTTATNTPRQASSAVYTLSLKTNQ
WRTAEPMLAPHFAHQSISFLHFIFVLGGLGSDRCVSNSVESTTRYNSMFNQWETMSPMPE
AVLHPAVAAADQRIYVFGGENAMQNPVRMIQVIPQPKNLWFKMENRTVKNISAPAAVIDD
KIYIVGGSYTRRVMAYDTKTNRFTNCANLKERRMHHAVTVLNHKLYITGGRYVTGHDLIE
DSDSVECYDPATDSWTSKGTLPYKLFDHGSMALTCVTQTL
Download sequence
Identical sequences ENSGMOP00000002882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]