SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000003084 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000003084
Domain Number 1 Region: 1-135
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 9.42e-49
Family TRADD, N-terminal domain 0.00019
Further Details:      
 
Domain Number 2 Region: 183-272
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000471
Family DEATH domain, DD 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000003084   Gene: ENSGMOG00000002941   Transcript: ENSGMOT00000003181
Sequence length 272
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_3322:183998:185789:1 gene:ENSGMOG00000002941 transcript:ENSGMOT00000003181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WSGGAVLFLESLCPHVNLLSLYKDPHHKFSLFKVIKLTLTDSAGGLGGYEILKLHDADPL
LGVELKFVELEACRRFLQSYVSGTLRQALAQHAGRLLAAAPEVKVETQLKAGTHTLDLCL
DSLEDCLEHIHLSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XTEDRILTAADVHSFSNGVGRQWKHVGRALARGCRALKGPAIDNLAYEYEREGLYEQAYQ
MLSRFTQAEGSAAKLGRLVGALEDCRLTGLAE
Download sequence
Identical sequences ENSGMOP00000003084 ENSGMOP00000003084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]