SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000003297 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000003297
Domain Number 1 Region: 347-614
Classification Level Classification E-value
Superfamily Kelch motif 4.71e-65
Family Kelch motif 0.0000518
Further Details:      
 
Domain Number 2 Region: 62-182
Classification Level Classification E-value
Superfamily POZ domain 3.92e-34
Family BTB/POZ domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000003297   Gene: ENSGMOG00000003140   Transcript: ENSGMOT00000003399
Sequence length 630
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1145:63936:67944:-1 gene:ENSGMOG00000003140 transcript:ENSGMOT00000003399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GNNPIIVKRKSIVALLEAACSRAKTDRIDLLLSPKEDSMKMSVCVHENRKSRGSTGSMNI
YLFHKSSYADSVLMHLNALRQQKLFTDVMLHAGRRSFPCHRAVLAACSRYFEAMFSGGLR
ESQASEVDFHDSIHPEVLELLLDYAYSSRVVINEENAESLLEAGDMLEFQDIRDACAEFL
ERNLHPTNCLGMLLLSDAHQCIKLSELSWSMCLSNFPAICKTEEFLQLPKDMVVQLLSHE
ELETEDEKLVYEAALNWITYDLQGRHPHLPELLKTVRLALLPAVFLMENVSTEPLINSQT
KSKELVDEAICCKLKILQNDGVVNSPCARPRKTSHALFLLGGQTFMCDKLYLVDQKAKEI
IPKADIPSPRKEFSACAIGCKVYITGGRGSENGVSKDVWVYDTVQEEWSKAAPMLIARFG
HGSAELKHCLYVVGGHTAATGCLPASPSVSLKQVEQFDPAVNKWTMVAPLREGVSNAAVV
SVKLKLFAFGGTSVTHDKLPKVQCYDPQENRWTVPASCPQPWRYTAAAVLGNQIFVMGGD
TEFSACSAYKFSSDSYQWTKVGDVTAKRMSCQAVASGNKLYVVGGYFGTQRCKTLDCYDP
TLDAWNSITTVPYSLIPTAFVSTWKHLPSR
Download sequence
Identical sequences ENSGMOP00000003297 ENSGMOP00000003297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]