SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000003402 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000003402
Domain Number 1 Region: 480-785
Classification Level Classification E-value
Superfamily L domain-like 9.86e-39
Family Ngr ectodomain-like 0.017
Further Details:      
 
Domain Number 2 Region: 52-423
Classification Level Classification E-value
Superfamily L domain-like 1.16e-33
Family Ngr ectodomain-like 0.043
Further Details:      
 
Domain Number 3 Region: 884-1037
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.01e-25
Family Toll/Interleukin receptor TIR domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000003402   Gene: ENSGMOG00000003222   Transcript: ENSGMOT00000003504
Sequence length 1053
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_4639:29999:33931:-1 gene:ENSGMOG00000003222 transcript:ENSGMOT00000003504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVYGVVLLLLSQLPLLGGRTPQFFPCDNNENSTEVYCLRRPLKDIPIFTSLNVTLLDLS
HTKIREVKRHVFTGIPNLLTLKMRWNCAPKTARTRIALSCHVNIQYDAFRSLHNLTYLYL
EGNSLTTIPWLPESIKVLDLESNCIFNIIIPFGTPHLEQLLLTMNCYYENPCYQPFYIHE
DVYKELSHLKNLTLGNNNMTSIPLGLPASLTSLDLKQNTITEIPEGAFAMLPNLEDLNLE
WNCQRCDHAARPCFPCPNNAPLQLHQNSFNVINSSLVYLSLRGNSLKNIPEGLFLPLTNL
KRLDLSSNYLAYTIRNATFFTELKQLTWISLIYNFQPLKTFHELILSPHLGNVSNLGTLL
LSGNFFSTVPEKSLVVLSRLQKLKTLEMRMNFLFYYNMSTLGMLPSLTRLDLSQNILSYL
PCNVSPGYSLEQGCQDPKVFKYFPDSPMLPVSAHGYDTEIESDTCRTPNNIVLEMGHFNQ
KFCRNNLTINLSQNNVIFLHEDVFDGMENVVCLNLSYNYASQALKGRLFIHLKSLVYLDM
SYNRIDLYHKEAFTELNKTLKVLDLSHNEYHFRMMGMGHRLEFIQSLTNLEVLNLANNGI
GTHIDPRLSSNSVEYMYFSGNHLNIMWQEGEGQTYIHFFQDLRKLIYLDISHNHLYSVEQ
HILCNLPVSLQALSISNNALHYFSWPNLTCLGNLSYLNLSVNHLSFLPYSFTEFPPDLHI
LDLSSNKITHLPDQFLSQAKALQCLYLNTNRLVVLNLQSLPTLLTNGTYFQLLTLHDNPF
SCDCYNSGLEVFLRTSHTRIPHLTTAVQCEFPESLQGQSVLTVDLRSCQEIYGGLAFLLS
TLFTCAFIALPLLRHLYGWDVWYCLQILWAGCKGYLHPSASCSPKHYDAFVVFDTNNQAV
RDWVYNELVIRLESSGYRRFSLCLEERDWIPGLSCIENLHNAVHSSGKTVFVLSNGTRND
VGEATVNGVIRQTFFMVQQRLLDEKVDVAVLILLDKMFPKLKYLQLRTRLCRKSVMSWPR
NPQAQPLFWNQMRTALSSDNLKLYDNNISEGFI
Download sequence
Identical sequences ENSGMOP00000003402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]