SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000003413 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000003413
Domain Number 1 Region: 484-789
Classification Level Classification E-value
Superfamily L domain-like 9.86e-39
Family Ngr ectodomain-like 0.017
Further Details:      
 
Domain Number 2 Region: 56-427
Classification Level Classification E-value
Superfamily L domain-like 1.03e-33
Family Internalin LRR domain 0.042
Further Details:      
 
Domain Number 3 Region: 888-1041
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.01e-25
Family Toll/Interleukin receptor TIR domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000003413   Gene: ENSGMOG00000003222   Transcript: ENSGMOT00000003515
Sequence length 1057
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_4639:29999:33786:-1 gene:ENSGMOG00000003222 transcript:ENSGMOT00000003515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISQVGIMKVVLLLLSQLPLLGGRTPQFFPCDNNENSTEVYCLRRPLKDIPIFTSLNVTL
LDLSHTKIREVKRHVFTGIPNLLTLKMRWNCAPKTARTRIALSCHVNIQYDAFRSLHNLT
YLYLEGNSLTTIPWLPESIKVLDLESNCIFNIIIPFGTPHLEQLLLTMNCYYENPCYQPF
YIHEDVYKELSHLKNLTLGNNNMTSIPLGLPASLTSLDLKQNTITEIPEGAFAMLPNLED
LNLEWNCQRCDHAARPCFPCPNNAPLQLHQNSFNVINSSLVYLSLRGNSLKNIPEGLFLP
LTNLKRLDLSSNYLAYTIRNATFFTELKQLTWISLIYNFQPLKTFHELILSPHLGNVSNL
GTLLLSGNFFSTVPEKSLVVLSRLQKLKTLEMRMNFLFYYNMSTLGMLPSLTRLDLSQNI
LSYLPCNVSPGYSLEQGCQDPKVFKYFPDSPMLPVSAHGYDTEIESDTCRTPNNIVLEMG
HFNQKFCRNNLTINLSQNNVIFLHEDVFDGMENVVCLNLSYNYASQALKGRLFIHLKSLV
YLDMSYNRIDLYHKEAFTELNKTLKVLDLSHNEYHFRMMGMGHRLEFIQSLTNLEVLNLA
NNGIGTHIDPRLSSNSVEYMYFSGNHLNIMWQEGEGQTYIHFFQDLRKLIYLDISHNHLY
SVEQHILCNLPVSLQALSISNNALHYFSWPNLTCLGNLSYLNLSVNHLSFLPYSFTEFPP
DLHILDLSSNKITHLPDQFLSQAKALQCLYLNTNRLVVLNLQSLPTLLTNGTYFQLLTLH
DNPFSCDCYNSGLEVFLRTSHTRIPHLTTAVQCEFPESLQGQSVLTVDLRSCQEIYGGLA
FLLSTLFTCAFIALPLLRHLYGWDVWYCLQILWAGCKGYLHPSASCSPKHYDAFVVFDTN
NQAVRDWVYNELVIRLESSGYRRFSLCLEERDWIPGLSCIENLHNAVHSSGKTVFVLSNG
TRNDVGEATVNGVIRQTFFMVQQRLLDEKVDVAVLILLDKMFPKLKYLQLRTRLCRKSVM
SWPRNPQAQPLFWNQMRTALSSDNLKLYDNNISEGFI
Download sequence
Identical sequences ENSGMOP00000003413 ENSGMOP00000003413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]