SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000003470 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000003470
Domain Number 1 Region: 468-771
Classification Level Classification E-value
Superfamily L domain-like 1.87e-39
Family Ngr ectodomain-like 0.012
Further Details:      
 
Domain Number 2 Region: 64-436
Classification Level Classification E-value
Superfamily L domain-like 3.74e-33
Family Ngr ectodomain-like 0.046
Further Details:      
 
Domain Number 3 Region: 869-1022
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.83e-25
Family Toll/Interleukin receptor TIR domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000003470   Gene: ENSGMOG00000003269   Transcript: ENSGMOT00000003572
Sequence length 1040
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_4639:37525:43340:-1 gene:ENSGMOG00000003269 transcript:ENSGMOT00000003572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CIFCACTLGPIQMMKVVLLILGQLPLLIARIPPFFPCDNNEIATEVYCAHRQLNDIPFFT
SINVTFLDLSHTKIRKMGQHKFSGIQNLITLKMKWNCDPKNLRTNNAYCRVRIEKDAFRS
LHNLTYLYLAGNSLTMLPWLPESIKVLDLESNCLFNIIIPFGTPHLEQLLLTKNCYYENP
CFQSFYIHEDVYKELSHLKNLTLGYNNLTSIPVGLPASLMTLDLKENTITEIPEGAFAML
PNLEDLNLGWNCQRCDHAAHLCFPCPNNASLLLHPNSFYAINSSVVYLTLRGNSLNNFPE
GLFLPLTNLKWLDLSDNYLAHTIRNGTFFTELKQLTWINLIYNFQPLGKFHDLILSPHLG
NVSNLETLLLSGYFFGTMSEQSIVVLSRLKQLKILEMRMNFISYFNMRTLGMLPSLSRLD
LSQNILSYLPYNVSHGYSLEKGSQDSIVFRDYSDLPMLPVSVHMYQTKFCQNKFTIDLSQ
NNVIFLHEDVFDGMENVVCLNLSYNYASQALRGRLFSRLKSLVYLDMSYNRIDLYYRDAF
SELNKTLKVLDLSHNEYHFRMMGMGHRIEFIQSLSNMEVLNLANNDISGRIDPRLSSSSV
QYMYFSGNRLDIMWEEEGQTYINFFQDLRKLIYLDISQNRLHSVEQPILCNLPVSLQALT
ISNNYLHYFPWLSLTCLGNLSHLSLSGNHLSYLPESVTEFPPDFSLLDLSNNWISHLPGQ
FFSRAESLQCLYLNTNRLVVLNLQSLPPLLKNGTSHQLLTLHHNHFSCDCYNSGLEEFLR
TSTTRIPNLTTDVRCEFPESLQGKSVLTVDQSNCQIYGGLVFLLSTIFTCAFIALPLLRH
LYGWDVWYCLQILWAGCKGYLHPSASCSPKQYDAFVVFDTNNQAVRDWVYNELVIRLESS
GYRRFSLCLEERDWIPGLSCIENLHNAVHSSGKTVFVLSNGTRNDADEATVNGVIRQTFF
MVQQRLLDEKVDVAVLILLDKMFPKLKYLQLRTRLCRKSVMSWPRNPQAQPLFWNQMRTA
LSSDNLKLYDNNISRTRTAP
Download sequence
Identical sequences ENSGMOP00000003470 ENSGMOP00000003470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]