SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000004038 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000004038
Domain Number 1 Region: 321-591
Classification Level Classification E-value
Superfamily Kelch motif 6.41e-55
Family Kelch motif 0.00034
Further Details:      
 
Domain Number 2 Region: 18-128
Classification Level Classification E-value
Superfamily POZ domain 3.36e-32
Family BTB/POZ domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000004038   Gene: ENSGMOG00000003812   Transcript: ENSGMOT00000004161
Sequence length 615
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_44:90385:103008:-1 gene:ENSGMOG00000003812 transcript:ENSGMOT00000004161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPINPTDEPRLYQQTLLQDGLSDLLENAKLVDCVLKIKGKAFPCHRLVLCACSAYFRG
IFLSDLDESKKKEIVLEDVEPGVMGLVLKYLYTSNINVTEQNVQDIFAVANMFQIPSVFT
VCVSFLQKRLSFSNCLAVFRLGLMLDCPRLAVSARNYACERFQFISKDQDFLQLGPSELA
AILACDTLNVETEETVFESLMKWVAEDVENREKELPRLLDCVRLRLVSEEYLREKVEKHK
LICSSNQEIEEMLQLVRDAHSGKLPELKLIKGKKGEAHEDGQNGEEEEQEEEALLPGILN
DNLRYGMFLRDLMFLVSDTGAVAYDPAGNDCYVASLSTQIPKNHTSLVTKENQIFVAGGL
FIDEQNKEDPMSSYFLQYDPANADWIGMPPIPSPRFLFGLAEAVSCIFVLGGKELKDQEH
TLDSVLVYDRQSLKWSEYDPTPYPVYGHATVSHNDIIYVIGGKEDSKKCLSAMSAYDARA
LQWRDLAPMSCPRSLCGATVHQDQIYVVAGVTDTGLTSSVEVYNISNNQWSDMVAFPQER
SSLSLVSMAGSLYAVGGFGMMPVEDSEELVPKEMNDIWRFNEEDRKWMGVLRNMQYAAGA
TILGVRLNTLRMTKI
Download sequence
Identical sequences ENSGMOP00000004038 ENSGMOP00000004038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]