SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000004121 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000004121
Domain Number 1 Region: 13-103
Classification Level Classification E-value
Superfamily Hormone receptor domain 1.7e-25
Family Hormone receptor domain 0.0018
Further Details:      
 
Domain Number 2 Region: 111-367
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000412
Family Rhodopsin-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000004121   Gene: ENSGMOG00000003871   Transcript: ENSGMOT00000004248
Sequence length 412
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_3103:166:11642:1 gene:ENSGMOG00000003871 transcript:ENSGMOT00000004248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLAEANAAVQTDHTANRITTAQYECFQRILKESQGPMCNRTWDGWLCWDQTEAGFTTEQF
CPDYFEDFDPKAMASKVCTDEGQWGRHPESSRTWTNYTTCKTHTVXXXXTAMNLFYLALL
GHGLSLTSLLISLAIFFHFKTLSCQRITLHKNLFFSFVLNSGITIIWYTTVNNHNDPVSC
KVIMFIHLYLMTCNYFWMLCEGIYLHTLIVVAVFAEKQHLLWYYLLGWGFPLVPALIHAV
ARYCYYNDTCWIRSDTSLLYIIHSPICAALLVNLFFLLNIVRVLITKLKVTHKAEFSLYM
KAVRATLILIPLLGIHFVLLPYKPSEVYQYVMNIFIHTQGLLVATIFCFFNGEVQTVLRR
HWNQQRMQFGGTFANADVFRSASYVASSLTEVHRCYSIESHTEYLNGKNYQD
Download sequence
Identical sequences ENSGMOP00000004121 ENSGMOP00000004121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]