SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000004511 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000004511
Domain Number 1 Region: 15-137
Classification Level Classification E-value
Superfamily POZ domain 1.45e-30
Family BTB/POZ domain 0.0013
Further Details:      
 
Domain Number 2 Region: 469-565
Classification Level Classification E-value
Superfamily Kelch motif 1.44e-26
Family Kelch motif 0.00065
Further Details:      
 
Domain Number 3 Region: 283-399
Classification Level Classification E-value
Superfamily Kelch motif 1.11e-25
Family Kelch motif 0.00001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000004511   Gene: ENSGMOG00000004256   Transcript: ENSGMOT00000004647
Sequence length 583
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1892:9783:21445:1 gene:ENSGMOG00000004256 transcript:ENSGMOT00000004647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMVVPSVRGLGYLDYNIESHASRSLSAMDEFRRHDLLCDLVLHVTQKDRTVDFKVHKLVL
ASASPYFRAMFSSSFKEGRASEVTLRDACPLVVGKLIDFAYTARITVGENCVLHVLLGAM
RYQMEDVAKACCDFLVKHLEPANVIGIARFAEGLGCTELQRHSREYINTHFNEVTKVEEF
FSLTHCQLLELISQDSIKVLCESEVYQACTNWVRWDIAGRAQYLHALLNAVRIYALPPKF
LKNQLQSCPILSKDNCCKDFLSKIFQEMALKKPLPPAPLRGNQLIYVAGGYHHRSLPTME
AFDPGRNVWLKLADMEAPCSGLGACVVFGLFYTVGGRNLSVQANTESGALCCYNPMTNRW
TSLASLNAPRNRVGVGVVDGAIYAVGGSQGSAHHATVERXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLVCLDAYLYAMG
GFDGRSQLCSVERYSIARDRWEPQEPMSQCRSAHAVTVHQGRIFVLGGFNQTGFLSSVEV
FCPDTNTWTGLSDMPFGRSGMGIAVTMEPCPGNLPEEEEEEEE
Download sequence
Identical sequences ENSGMOP00000004511 ENSGMOP00000004511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]