SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000004537 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000004537
Domain Number 1 Region: 449-684
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-67
Family Protein kinases, catalytic subunit 0.000000188
Further Details:      
 
Domain Number 2 Region: 820-947
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 2.75e-40
Family FAT domain of focal adhesion kinase 0.0000414
Further Details:      
 
Domain Number 3 Region: 140-261
Classification Level Classification E-value
Superfamily Second domain of FERM 4.53e-33
Family Second domain of FERM 0.0000372
Further Details:      
 
Domain Number 4 Region: 263-367
Classification Level Classification E-value
Superfamily PH domain-like 8.24e-27
Family Third domain of FERM 0.00013
Further Details:      
 
Domain Number 5 Region: 41-139
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.14e-26
Family First domain of FERM 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000004537   Gene: ENSGMOG00000004240   Transcript: ENSGMOT00000004673
Sequence length 947
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_3069:33324:60414:-1 gene:ENSGMOG00000004240 transcript:ENSGMOT00000004673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGDSGTLSWKSTSSATSRSNSLAPQSAVDRDGGLAPLTPKIVKVCFFGQGSNLGSNFKL
VRCEEGWTIRSIISAVLNSGCVGPDIRYPLCYGLLLRHLKSAAEHWLHPGLSIPELMHSY
ERQHLEAEWRYDLRIRYIPQDFLEKFKEDRSSMLYLYQQVRSDYMHHYATKVSDGMALQL
GCLEIRFCKDLSLNALEKKSNIELLEKDIGLDVFFPRELIVSMKPKQLRKMIQQTFQGYY
TLTEELCIARFFTTLAQCYSFTQESFPCQLVQGWSLSIDLVISPDGISQRADKESLPVLL
ASFGQVRSIQCSKESDGRAMLNVHMEGAGQPLSVNISSMAMAENMADIIDGYCRLQTNSE
NSLIVRPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXTGERIRVAVKTCKDCSADVKEKFLSEAVLMKTLNHQ
HIVRLVGVIEWDPVWIVMELYEHGELGSYLVQHQRSLTPATLSLYCVQVCKAMAYLEGLN
MVHRDIAVRNVLVASPDCVKLGDFGLSRFIEEEDYYKASLTRLPIKWMAPESINFRRFTT
ASDVWMFGVFVWEVLSLGQQPFFWMENGQVINHLEAGTRLPKPDLCPPPLYSLLGRCWAY
QPAARPKFSQLVCTLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGKV
HEDSRSPWERERESVEDTLWRQKQDMLRDREWLEQEERSKPLPTAEMDRSGDQVYSSVME
MVKEVVRLKNDVKTLSASEYPTAVKXXXXXXXXXIQSVDEILPTLHSSVRNEIKGTERLL
NKDLGELISKMRLAQQNAVTSLRQDCQRQMLAAAHTLAVDSKSLLDA
Download sequence
Identical sequences ENSGMOP00000004537 ENSGMOP00000004537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]