SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000004693 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000004693
Domain Number 1 Region: 330-581
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.37e-73
Family Tyrosyl-DNA phosphodiesterase TDP1 0.000000032
Further Details:      
 
Domain Number 2 Region: 126-328
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.18e-70
Family Tyrosyl-DNA phosphodiesterase TDP1 0.000000192
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000004693   Gene: ENSGMOG00000004397   Transcript: ENSGMOT00000004833
Sequence length 582
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_3293:9406:18220:-1 gene:ENSGMOG00000004397 transcript:ENSGMOT00000004833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FVFLASLHGKWAVSSSDDDDGEELPSSKTVSSGPSHPTTPPCPLIASLSARDSQSNPGKY
ESPLSGKRKKDQEESGWALSDSDGDDDAVGLGNKANNPTSRRAPSPKAKKPKVDERPPSP
YGRVYIEETDDFFETHVPCLNDTYRFYLNKVTGLDKTYNTGALHIRDILSPLFGTLKESV
QFNYCFDIPWMVEQYPPEFRDLPVLIVHGDKREAKARLLKQAQPFPHVRFCQAKLDIAFG
THHTKMMLLWYEEGFRVVITTSNLIRADWYQKTQGLWLSPLFPRLPDGSVQGESPTLFKK
DLLEYLASYRAPELGEWIQRIREHDLSETRVYLIGSTPGRYLGDDMDRWGHLRLRKLLYD
HSIPVPDDEIWPVIGQFSSIGSMGLDKTKWLAGEFQRTLTTLGRSSVRQDPPIHLVYPSV
DDVRNSLEGYPAGGSLPYSIQTAEKQLWLHSYFHRWKADTTGRSQAMPHIKLYMRASPDF
TKLAWFLITSANLSKAAWGNLEKNNSQVMVRSYELGVLYLPSAFXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXQPWIWNIPHNQSPDTHGNIWVPS
Download sequence
Identical sequences ENSGMOP00000004693 ENSGMOP00000004693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]