SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000004898 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000004898
Domain Number 1 Region: 2-555
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 6.71e-134
Family Myeloperoxidase-like 0.00000464
Further Details:      
 
Domain Number 2 Region: 774-905
Classification Level Classification E-value
Superfamily EF-hand 4.1e-25
Family Calmodulin-like 0.0077
Further Details:      
 
Domain Number 3 Region: 1213-1313
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 0.00000000000000511
Family Ferredoxin reductase FAD-binding domain-like 0.0076
Further Details:      
 
Domain Number 4 Region: 1323-1404,1431-1483
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 0.0000000000000419
Family Flavohemoglobin, C-terminal domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000004898   Gene: ENSGMOG00000004566   Transcript: ENSGMOT00000005040
Sequence length 1491
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1297:187264:205829:1 gene:ENSGMOG00000004566 transcript:ENSGMOT00000005040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DWEVQRCDGWYNNLGYPNRGAVGSHLMRLMPAHYSDGVAHPIQEPQHPNPRLLSRALTAG
PSGLPSARNQTVLSVFFGYHLTFEIFDSRMPGCPPEFMNIDIPKGDPVFDPSSTGEVELP
FHRGPWDKDSGQSPNNPRVQVNLVTAWIDGSSIYGPSSSWSDTLRSFSGGLLTSGHQWNM
PAGRLRMWSAPDPSTGDHGPAGLYEFGNAWANENLFTAAEGIIWFRYHNYLAVRLKMEQP
GWSDEKLFQHARKTVVATLQNIALYEWLPVYLGNGTLPLYPGYQKFVDPGISPEFEVAAI
RLGITAVPPGVYMRNRTCHFREVVNADGSLSPALRLCNSFWKRETGQDVDDLVMGMASQI
AERTDNVVVEDLRDYMYGPLRFSRSDLVALTIQRGRDFGIPTYSEVRQALDLPAIMTFGE
INPELNRSNPQLFQDVAELYDGDVSKLELFPGGLLEALHGPGAVFSRVVLDQFERIRNGD
RFWFENRQNGLFTPSEIQALRKVTYHDVLVAVTGAEAGDVQEHVFLWMDGDPCAQPAQVN
ASGLHPCTPFTTLNYFDGSKAGFGIFVVCLFLFPVVSLIVACMVAYIRKARYKRFKKRRM
AVRGTEEPASGIMAYEWCGHKKPLQSVSVEVNEKRRVQVFDHAGSVLRSLNLGSQTSLKI
LLSNDHQQKVLLLKVPKEYDLVLFFEDESKRAELVRQLNPEAEGSGQHIAVTQMREKDIL
GEALTREQRAQIVETFIRHAFSEVLEIEKRDAGDMSGTARHKTRQVLQCELAATELADAL
GLKPDSLFVDSMFTLADKDGNGYLSFQEFLDVIVIFMKGSPEEKSKLMFSMHDIAGNGFL
SKEDFTRMLRSFIEISNGALSKSQADEGILAMLKTAGFEDKELITWEDFHFLLRDHEKEL
QFSELNVKGGRKNGAAGEEEVQSRTTCLLHLPGQQNETAKQELRRRQRSGPKVYVKPRRD
HYERNPIQQKIQEFKRFVENYRRHIVCFLVVYGIVAGVIIERCYHYALQADASGVPETSM
VGIIVSRGSAAAISFLFPYMLLTVCRNLITLLRETFLNRYIPFDAAIDFHRFMAMIAILM
AVIHSLGHVVNLYIFSISDLNILACLFPKVLPNNGSELPLKWYYWFFQTVPGMTGVLLLF
VLAFMYVFASHVFRRISFRGFWITHYLYVVVYILTVVHGSFALLQSPRFYIYLIPPALIF
LLDKLISLSRKKVEIPVLRAELLPSGVTHLEFKRPQGFVYRSGQWVRIACLMLGTDEYHP
FTLTSAPHEENLSLHIRAVGPWTSHLRELYTEDRLVELGFHPKLYLDGPFGEGHQEWIDF
DVSVLVGGGIGVTPFASILKDLVVKSSNKAKIQCKKVYFIWVTRTQRQFEWVSDIVREVE
EMDTLELVSVHIYITQLAQKFDLRTTMLYVTERHFQKVWNRSLFTGLRSITHFGRPPFVA
FLSSLQEVHPEVHKMGVFSCGPPGLTKNVEKACQQMNKKDQAHFVHHYENF
Download sequence
Identical sequences ENSGMOP00000004898 ENSGMOP00000004898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]