SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000005223 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000005223
Domain Number 1 Region: 437-643
Classification Level Classification E-value
Superfamily Kelch motif 3.01e-62
Family Kelch motif 0.00000544
Further Details:      
 
Domain Number 2 Region: 348-482
Classification Level Classification E-value
Superfamily Kelch motif 6.41e-38
Family Kelch motif 0.00018
Further Details:      
 
Domain Number 3 Region: 9-130
Classification Level Classification E-value
Superfamily POZ domain 1.1e-22
Family BTB/POZ domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000005223   Gene: ENSGMOG00000004931   Transcript: ENSGMOT00000005380
Sequence length 650
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1132:8230:15942:-1 gene:ENSGMOG00000004931 transcript:ENSGMOT00000005380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPNGYLIFEDESFLDSTVAKMNALRKSGQFCDVRLQVCGHELMAHRAVLACCSPYLFEI
FNSDIEPHGVSHVTFEDLDPAAVEILVKLVKEDLFFLLKADQELVKEVYSAAKKFKMDRV
KQICGDYLISKMESQNAISFRNFASSMGDGRVLAIVDAYIQDHLLDVSEQDDFLKLPRLK
LEVMLEDNLALPSNGRLYSKVLNWVQHSLWENGENLEQMMEEVQTLYYSADHKLVHGGLV
IEGHTEVFGGEEDRLQFVQKKPPRESTQRQMSCSSSGSLSPSSQAPSAPKQSSRREWKYI
ASEKTTNNTHLCLAVLDGTLCVVFLHGRSSPQTSPSATPCLMKSMSFEAQPELLEQRLLA
PMHYARSGLGAAALGGRLIAAGGYNREECLRTVECYDPELDRWTFIAPMRTPRARFQMAV
LMGRLYVMGGSNGHSDELSCGETYDPLTDDWAQVPELRTNRCNAGVCSLDNQLYVVGGSD
PCGQKGLKNCDAYDPVTKAWTNCAPLNTRRHQAAVCSLDGFVYVIGGAESWNCLNTVERY
DPRIDTWTLIAPMNVARRGAGVAVHAGSLFVVGGFDGSHALRCVEVYEPARGEWRMLGSM
TSARSNAGVALLGALVVAVGGFDGNDFLNSMELYDPATDRWSEDTDATPP
Download sequence
Identical sequences ENSGMOP00000005223 ENSGMOP00000005223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]