SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000005539 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000005539
Domain Number 1 Region: 3829-4103
Classification Level Classification E-value
Superfamily YWTD domain 5.49e-45
Family YWTD domain 0.00000549
Further Details:      
 
Domain Number 2 Region: 1845-2101
Classification Level Classification E-value
Superfamily YWTD domain 6.54e-45
Family YWTD domain 0.0000173
Further Details:      
 
Domain Number 3 Region: 180-450
Classification Level Classification E-value
Superfamily YWTD domain 1.03e-39
Family YWTD domain 0.0000712
Further Details:      
 
Domain Number 4 Region: 513-774
Classification Level Classification E-value
Superfamily YWTD domain 1.2e-39
Family YWTD domain 0.00000695
Further Details:      
 
Domain Number 5 Region: 1290-1489
Classification Level Classification E-value
Superfamily YWTD domain 4.19e-38
Family YWTD domain 0.0000143
Further Details:      
 
Domain Number 6 Region: 1539-1796
Classification Level Classification E-value
Superfamily YWTD domain 4.58e-36
Family YWTD domain 0.0000523
Further Details:      
 
Domain Number 7 Region: 2163-2420
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-35
Family YWTD domain 0.0000388
Further Details:      
 
Domain Number 8 Region: 3113-3242
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-23
Family YWTD domain 0.0000785
Further Details:      
 
Domain Number 9 Region: 2890-2976,3235-3289
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.81e-17
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 10 Region: 1115-1217,1482-1534
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000314
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 11 Region: 50-66,100-169,771-821
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000188
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 12 Region: 824-865
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000458
Family LDL receptor-like module 0.00014
Further Details:      
 
Domain Number 13 Region: 3525-3565
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000982
Family LDL receptor-like module 0.00058
Further Details:      
 
Domain Number 14 Region: 2642-2678
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000419
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 15 Region: 865-907
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000445
Family LDL receptor-like module 0.00066
Further Details:      
 
Domain Number 16 Region: 3486-3525
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000497
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 17 Region: 3566-3602
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000089
Family LDL receptor-like module 0.00056
Further Details:      
 
Domain Number 18 Region: 2686-2719
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000982
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 19 Region: 3609-3654
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000103
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 20 Region: 906-945
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000106
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 21 Region: 2859-2900
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000119
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 22 Region: 2511-2552
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 23 Region: 3443-3483
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 24 Region: 3-42
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 25 Region: 2772-2807
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 26 Region: 2727-2761
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 27 Region: 3326-3363
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000353
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 28 Region: 2551-2591
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000419
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 29 Region: 3406-3441
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000772
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 30 Region: 1034-1071
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000236
Family LDL receptor-like module 0.00027
Further Details:      
 
Domain Number 31 Region: 1799-1848
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000503
Family EGF-type module 0.015
Further Details:      
 
Domain Number 32 Region: 2809-2848
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000537
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 33 Region: 3366-3404
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000628
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 34 Region: 3693-3732
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000511
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 35 Region: 2476-2513
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000668
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 36 Region: 3654-3687
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000144
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number 37 Region: 2984-3049
Classification Level Classification E-value
Superfamily YWTD domain 0.00000173
Family YWTD domain 0.0015
Further Details:      
 
Domain Number 38 Region: 2107-2157
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000176
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000005539
Domain Number - Region: 4194-4229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000187
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 4229-4265
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000203
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 4159-4191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000244
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 3781-3817
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000457
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 950-975
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00122
Family LDL receptor-like module 0.0037
Further Details:      
 
Domain Number - Region: 466-502
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00245
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 4267-4299
Classification Level Classification E-value
Superfamily EGF/Laminin 0.013
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 3736-3787
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0248
Family EGF-like domain of nidogen-1 0.074
Further Details:      
 
Domain Number - Region: 2431-2491
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0463
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 4111-4143
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0807
Family EGF-type module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000005539   Gene: ENSGMOG00000005081   Transcript: ENSGMOT00000005705
Sequence length 4502
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1722:375582:472743:-1 gene:ENSGMOG00000005081 transcript:ENSGMOT00000005705 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAPKTCSPKQFVCKDQVTCISKGWRCDGEKDCPDGSDESPDICTHHRMNQCPVNEHGCLD
PDVCIHLSKMCDGVPDCSEGWDEGPHCRVSEKAPGCHFEGCQFNCSVTHEGPKCYCNPGY
EVGPDGKICKDFNECMVYGACSQTCTNTEGSYLCSCVEGYLLQPDNRSCKAKNVPVDRLP
MLLIANLHDIRCTSLSGSTSRLPSITTKQTMAMDFVYALEMVCWIDVGDTAATTQLKCAN
IPDLKVLGDVRTINISLSLHHVEQMAIDWLTGNFYFVDDVDDRVFVCNKDGGTCVTLLDQ
ELYNPKGIALDPAMGKVFFTDYGSTPRVERCDMDGQNRTKLVDSKIVFPHGITLDLVNRL
VYWADAYLDYIEVVDYEGKNRHTIIQGLLIEHLYGLTVFENYLYATNSDEGNLNPKTSVI
RVNRFNSSDFQVVTRVDRGAALHVYHQRRQPQVRSHACALDQFRKAGGCSDICLLGNSHK
TRTCRCRSGHSLGSDGKSCKRPEHELFLVYGKGRPGIIRGMDMNAKVPDEYMIPIENLMN
PRALDYHAASEFIYYADATSYIIGRQKIDGSDGDTILKEGIHTVEGIAVDWIGGNLYWTD
DGPKKTISVARLEKASQTRKTLIEGKMTHPRAIVVDPQHGWMYWTDWEEDPTVSNRGKIK
KAWMDGSNHQVFLTSKTVLWPNGLSLDIPQGILYWVDAYYDRIEMVYLNSSARKVVYEGQ
ELNHAFGLCHYKQFLFWNEYRGGSIYKLDQDSKTVTLLRNERPPIFEIRVYDADQQQVGT
NACRSNNGGCSSLCLVIPDGRSCGCADDQILDEDNITCKANPSYVPPPQCQPGEFACKNN
RCIQERWKCDGDNDCLDNSDELPELCHQHTCPSDRFKCQNNRCIPVRWLCDGDNDCGNDE
DESNTTCSARTCPPNQYPCTSGRCIPISWTCDLDDDCGDRSDEPDSCAYPTCFPLTQFTC
ANGRCINVNWRCDNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXTRPPGGCHVDEFQCKMDGLCIPMRWRCDGDNDCMDLSDENCKGVTHMCD
PAVKFLCKDSARCIINCEATVCKLSHHVCATNDSICLPGEKLCDGTDDCPDGSDEKLCDL
CSVDNGGCSHNCSIIPGEGFMCSCPLGMELGADNKTCQIQSFCAKHLKCSQRCEQEKASV
KCSCYEGWELEADMESCKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXLTSFEVVIQYGLATPEGLAVDWIAGNIYWVESN
LDQIEVAKLDGTMRTTLLAGDVEHPRAIALDPRDGILFWTDWDASLPRIEAASMSGEGRR
TIHRETGSGGWPNGLTVDYMERRIVWIDARSDAIYSALYDGTGLIEVLRHEFLSHPFAVT
MYGGEVYWTDWRTNTLAKANKWTGGNVTVVQRTNTQPFDLQVYHPSRQPQAPNPCAAVDG
KEPCTHLCLINFNQTFSCACPHLMKLQPDKRTCKESRKFLLYARQIEIRGVDIDNPYYNY
IISFTVPDIDNVTVVDYDAVEQRIYWSDVRTQTIKRAFINGTGVETVVSADLPNAHGLAV
DWVSRNLFWTSYDANKKQINVARLDGSFKNAVIQGLDKPHCLVLHPMLGKLYWTDGDNIS
MANMDGGNRTTLFTNQRGPVGLSIDFEKEQLYWISSGNSTINRCEMDXXXXXXXXXXXXX
XXXXXXXXXXXDKLWWADQGSDQIGTCDKKDGGSWKVLRNNTSPMFHMRIYDEEVQKGGI
NLCSNNNGDCSQLCLPTSPTSRACMCTAGYSLKTEQQSCEGMGSFLLYSVHEGIRGIPLD
PGDKSDALVPVSGTSLAVGIDFHAENDTIYWVDMGLSTISRAKRDQTWREDVITNGIGRV
EGITVDWIAGNIYWTDQGFDVIEVARLNGSFRYVVISAGLDKPRAITVHPVKGYLFWTEW
GQYPRIERSRLDGSQRLVMVNVSISWPNGISIDYQEGLLYWCDARTDKIERINLETGENR
ELVLANNNMDMFAVSVFEGYIYWSDRTHANGSIKRGSKDNATDSVQLRTGIGVQLKDIKV
FNRARQQGTNVCKVDNGGCEQLCLFRGNGQRTCACAHGMLAEDNSSCRDYDGYLLYSERT
ILKSIHLSDETNLNAPIKPFEDPEHMKNVIALSFDYHGGGGKGANRVFFSDIHFGNIQQI
NDDGTDRKIVVDNVGSVEGLAYHRGWDTLYWTSYTTSTISRHTVDQSRSVAYNRNTVVTM
SGDDHPRAFVLDECQDIMFWTNWNEQAPSIMRASLNGANVLVIIGSDIKTPNGLAVDHRA
EKLYFSDATLDKIERCEYDGSNRYMLLKNEPVHPFGLAVYGDYIFWTDWVRRAVLRADKY
TGGDMKVLRADIPQQPMGIIAVANDTNSCEFSPCRTNNGGCQDLCLPTSDGRVNCSCRGD
RRLLEDNMCSALNISCGSVEDFECGNGDCINYSLTCDGMAHCKDKSDEKQSYCANRLCKK
GYRRCINGRCIGHQFWCDGTDDCGDHSDELPCNMTLCKLGEFQCKDGSCISNYSRCDQVV
NCEDASDEMNCQATDCARFFRLGVKGASFQSCERTTLCYRPGXXXXXXXXXXXXXXXXKR
KLKCPVNFFACPSGRCIPMSWTCDKENDCENGADETHCXXXXSLDKFCTFSQFECSNHRC
ISSRWVCDGADDCGDGSDEDLKCKSKTCSPEAFQCPGSHMCVPQRWKCDGDKDCPDGADE
SVKAGCLYTSNNTCDENEFMCQNRQCIPKHFVCDHDIDCSDGSDESPECDYPTCGPEEFR
CANGRCLNQKSWECDGEFDCQDRSDEAPKNSHCTDSERKCNESAFMCRNGKCLNETLLCD
RNDDCGDGSDELNCFINECLNSKLSGCTQLCDDLKIGFKCRCEAGFQLKRDGKTCVDVDE
CTTSYPCTQRCINTHGSFHCLCVDGFELSPIDPTICKSTSEKEPYLIFANRYYLRKLNLD
GSNYTLIKQGLNNAVALDFHYAEQMIYWTDVTTQGSMIRRMRMNGSNVEXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYLYWSDWG
ENPHIGRVGMDGTNRSVVVEDRITWPNGLTLDLINDRIYWADAREDYIQFASMDGSNRHT
VLTQDIPHIFAMTLFEEYIYWTDWETKSINRAHKTLGTNKTTLISILHRPMDVHIYHPYR
QPEVLDHPCQTDNGGCSNLCLLSPGEGYKCACPTNFYLAKDRHTCMSNCTASQXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXEFKCRPGQFQCGTSICTNPAYICDGDNDCQDNSDE
ANCDIHVCLPSQFKCSHPSRCIPGIFRCNGQDNCGEGEDEKDCPEVTCAPAQFQCAITKR
CIPRVWVCDRDNDCVDGSDEPANCTQMTCGVDEFRCKDSGRCIPARWKCDGEDDCGDSSD
EPKEECAERTCEPYQFRCKNNRCVPGRWQCDYDNDCGDNSDEDECVPRQCSESEFACKNG
RCIAGRWKCDGDHDCADGSDEHECVLKCDQDQFQCKNAHCIPIRWRCDADADCMDGSDEE
KCGSAAGRHCPLDEFQCNNTLCKPQAWKCDGEDDCGDNSDENPDECRRFQCPPTRVFRCQ
NDRVCLQLSKRCDTVNHCGDNSDELHCADVIPAVPSCDKDQFLCANGKCISSTLICNYFN
DCEDYGSDEIKCKTDTKVNDCRSNRTQCGDGDEAHCVTNGTDSFCSCKPGFQKTGHRTCG
DKNECQQFGACSHMCNNTKGSHMCSCHKYFTKIHDTCKADSMNSSRQILYIADDNEIRSL
DPGVPNWRYEQTFQGDASVRIDAMDLHVKTNRIFWTNWHRGQISSYELPGPPTSSSSGSS
PSEGRVSNLQIPELKMPRGIAVDWVAGNLYWTDSGRDVIEVAQMSGQNCKTLISGMIDEP
YAIVVDPQRGTMYWADWGNHPKIETAAMDGTLRQTLVHENIQWPTGLAVDYFNERLYWAD
AKLSVIGSVRLDGSDPVIAASGIKNKLLHPFSIDIFEDYIYGVTYINNIVFRVNKFGKGT
MENLTTGINHATDIVLYHRYKQPEMTNPCDRKKCEWLCLLSPSGPVCTCPNNYVADNGTC
VERAQPTQSPFSPPSGPCTIQCQNGGSCFLNAHQQAKCRCQPNYRGERCEINQCRDYCKN
GGTCTASQAGNPTCRCLQGFTGPHCNLQTCQNYCTNGGTCSVNVGNQATCSCPADYHGDQ
CQYSMCEGFCEHGGTCLQTSNGTKLCQCQSQYHGHNCELDKCQYCGDGKCHTSASGEVSC
SCSNGQTQPSCYSCLDFCLNQCSVDNRSLLPQCRCNVGWVGFRCSVTAAPIDSSSSGSSA
SIIIPVLLLLLLALLVVGAILWYKRRMRGAKGFQHHRMTNGAMNVEIGNPAYKIYEGEPD
DDAGELLDSDFALDPDKPTNFTNPVYATLYMGAHNSRNSLASTDEKKELLSAADDDMSDP
LA
Download sequence
Identical sequences ENSGMOP00000005539 ENSGMOP00000005539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]