SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000005561 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000005561
Domain Number 1 Region: 307-539
Classification Level Classification E-value
Superfamily Kelch motif 2.62e-26
Family Kelch motif 0.011
Further Details:      
 
Domain Number 2 Region: 744-888
Classification Level Classification E-value
Superfamily C-type lectin-like 7.17e-24
Family C-type lectin domain 0.0019
Further Details:      
 
Domain Number 3 Region: 63-185
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.13e-22
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 
Domain Number 4 Region: 715-759,888-924
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000957
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000005561   Gene: ENSGMOG00000005213   Transcript: ENSGMOT00000005727
Sequence length 1263
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1372:6966:86037:-1 gene:ENSGMOG00000005213 transcript:ENSGMOT00000005727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FYLCFRINPFGLLTPLLVLFSVVGLLSGSPAVDVKDCDKPCVNGRCNTATGGCVCLAGWV
GEQCQHCGGRFRLTGPSGYLTDGPGNYKYKTKCTWLIEGQPNTILRLRFNHFATECSWDH
LYVYDGDSIYAPLLAAFSGLIIPERYGNETTPEVASVSGYALLHFFSDAAYNLTGFNISY
RVNSCPNDCSGRGECRPGNGTGLAVQCECEDQWKGEACQVPYCQADCGYPERGYCQTSNK
ACSCYPGWQGAELQEAGRGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXFDLTAWSWLSLDASVNVVTPRYGHSLAEYEGKVYMYGGKIDSTGNVSTQLWF
HVQNQTWVLLSPRAKEQYAVVGHTAHVVPPLADQEEGGGAGGAVMLVLFGHCPLYGYISQ
VQEYDIARNSWRMVSTDGALVQGGYGHSSVYDPASRSIYLHGGYKAYSANKYGLAGDLYK
YQVEGSKWTILRDSGFYRYLHSAVLMGGAMLVFGGNTHNDTSMSHGAKCFSTDFMSYDLX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGAVSEYDGCPKDNASFVCNKKT
SCKSCSSDQNCQWEPRNQECISLPGNVCGESWHLVGNSCLKFLTAKDSYDNAKLACRGYS
GVLASLTSPKEVDFVLKELQIMSVVYKALVTPWVGLRKINVSYWCWEDMSPFSNTSLQWL
PGEPSDAGFCGYLAEPAASGLRAQSCINPVNGSLCERPANHSAKPCRTPCAMRTNCNECT
ISSSECMWCSNMKQCVDSNAYVASFPFGQCMEWYTLSTCPXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXTLLIDYQFTFSLSQEDDRYYIAINFVATPEEPNR
DLDMFINASKNFNLNITWATSFTAGTQSGEEIPIVNRINIKEFKESFSNENFDFRNNPNI
TFFVYVTNFTWPIKIQIAFSQHSNFMDLVQFFVTFFSCFLSLLLVAAVVWKIKQSCWASR
RRE
Download sequence
Identical sequences ENSGMOP00000005561 ENSGMOP00000005561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]