SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000005782 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000005782
Domain Number 1 Region: 61-163
Classification Level Classification E-value
Superfamily Second domain of FERM 4.58e-25
Family Second domain of FERM 0.00058
Further Details:      
 
Domain Number 2 Region: 2-59
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000145
Family First domain of FERM 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000005782   Gene: ENSGMOG00000005448   Transcript: ENSGMOT00000005951
Sequence length 174
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1973:77103:78654:1 gene:ENSGMOG00000005448 transcript:ENSGMOT00000005951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIVAHSNLVEHFYFGLAYVDDNEFFFLDTDTKISKVAPDSWKKVPTTPFILYFRVKFFVS
DISLLLHKLSRHQYYLQLRKDFLEDRLSCHEESSLYLAGLALQAEYGDCMPEVYGRSYYR
VDHYISKSVMEKRALPSIKDELLRLHASNTQMLSDESELEFLKPEYGVLFYRVV
Download sequence
Identical sequences ENSGMOP00000005782 ENSGMOP00000005782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]