SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000005839 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000005839
Domain Number 1 Region: 11-121
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000606
Family V set domains (antibody variable domain-like) 0.03
Further Details:      
 
Domain Number 2 Region: 326-418
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000003
Family I set domains 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000005839   Gene: ENSGMOG00000005494   Transcript: ENSGMOT00000006012
Sequence length 451
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1022:98760:217954:1 gene:ENSGMOG00000005494 transcript:ENSGMOT00000006012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YLTVTIEPLPPVVVGETVTLKCNFKTDGRLREIVWYRVTDGGTIKQKIFTYDAMFNTNYS
HMEDYRRREDLVYQSTVRLPEVRISDNGPYECHVGIYDRATREKVVLASGNVLLTVMSPP
NNISVMAENTPAPFSRYQAQNFTLVCTARGGKPAPSXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXAPKGPKLLMSPSRAKVGDTVRITVQGFQVGASGNEVFPEPLYTW
TRVGGRLLDGSAEREGKELILERVPAELNGSMYRCTAQNPLGSTDTHTRLIVFENPSMME
HTQSQNSGVSCVDLLGLAWMALVVTVTVELT
Download sequence
Identical sequences ENSGMOP00000005839 ENSGMOP00000005839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]