SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000005998 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000005998
Domain Number 1 Region: 320-612
Classification Level Classification E-value
Superfamily Kelch motif 7.45e-69
Family Kelch motif 0.0000655
Further Details:      
 
Domain Number 2 Region: 52-167
Classification Level Classification E-value
Superfamily POZ domain 4.63e-22
Family BTB/POZ domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000005998   Gene: ENSGMOG00000005654   Transcript: ENSGMOT00000006173
Sequence length 635
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1260:1169201:1171211:1 gene:ENSGMOG00000005654 transcript:ENSGMOT00000006173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPKKNKATKKNKGEINEMTIMVEDSPVTKINGLNTLLDGGNGFSCISTEVTDAVYAPNL
LEGLSKMRQDSFLCDLTVATKSKSFDVHKVVMASCSQYIQNILKKDTALQTIDLNELSPV
GLATAITYAYSGKLTLSLYSIGSTIAAAMLLQIHTLVKMCSDFLMQELSVENCMYVANIA
DTYDLKETKKAAQKFMRENFIEFSEMEQFLKLTFEQICDFLSDDSLQLPSEVTAFQIAMR
WLDFDEKRLRYAADLLTHIRFGTISAQDLVNHVQNAPRMMQDPECHRLLVDAMNYHLLPF
QQNILQSRRTKVRGGVRVMITVGGRPALTEKSLSKEVLYRDADSVWNKLTEMPAKSFNQC
VAVLDGFLYVAGGEDQNDARNQAKHAVSNFCRYDPRFNTWIHLSNMIQKRTHFSLNTFNG
LLFAIGGRNSDGVQASVECYVPSSNQWQTKAPMEVPRCCHASSIIDGKILVSGGYINNAY
TRAVCSYDPSTDSWQDKSSMSTPRGWHCAATVGDRAYVLGGSQLGGRGERVDVFAVECYS
PQNGQWSYCAPLRTGVSTAGVALLNEKVYLLGGWNEVEKKYKKCIQVYSPDINEWTEDDE
LPEATVGISCCMVNIPTRKTRESRASSVSSAPVSI
Download sequence
Identical sequences ENSGMOP00000005998 ENSGMOP00000005998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]