SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000006153 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000006153
Domain Number 1 Region: 2054-2104
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000111
Family RING finger domain, C3HC4 0.0061
Further Details:      
 
Domain Number 2 Region: 468-597,639-751
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000108
Family Extended AAA-ATPase domain 0.06
Further Details:      
 
Domain Number 3 Region: 830-1057
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000504
Family Extended AAA-ATPase domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000006153   Gene: ENSGMOG00000005695   Transcript: ENSGMOT00000006329
Sequence length 3221
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1475:55849:76268:-1 gene:ENSGMOG00000005695 transcript:ENSGMOT00000006329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCSSEREHAYIPSAFSKYRLQMVPQEPTARIQSYLSRHYSVPADECSAAAVFRDRLSVG
VVSSERAGVGKSLYVKRLHGKLKRSSERPSVLKCIRLIEPKVDENAILQSLLESTKKEDL
TIFHLDVTASVQKGLHDFLFKLLILRYLMDSEGMMWKCCNKQLYLIEILKSPFPLNVSRQ
VRSQTMNSSFIDWFPNIFCRPPKEVLMLEMEKNEVPAPFNPDQPLMDDEEFRSEAFQRPY
QYLTQFHNRRDLDTFKYNAVEGSHVECLQMLLMYCGIMDPSWAEIRNFAWFLNLQLKDCE
TSVFCNVNLVGDTLRGFKSFVVDFMILMAKDFATPSLSISDQSPGRLQFDLSGLRDEDLA
PFLIRKRWESEPHPYIFFNGDHVSMTFIGFHLQPNGNKSLDAIDPSSKRIIRKDIMTKEL
FDVLTLQGVPFNINFEQLPRGEKIESICHVLGIQRPHDPDKTYELTTDNILKILAIHMRF
RCGIPVIIMGETGCGKTRLIKYLCELQRGEVATENMKLVKVHGGTSSDIIYTKVREAEAI
SSKNKENFGFDSVLFFDEANTTEAIGSIKEIICDHTVKGESLRLNCGLQIIAACNPYRKH
TEEMITKLESAGLGYRVRAEETDEKLGSIPLRQLVYRVQALPPSMIPLVWDFGQLNDNTE
EMYIQQIVQRVVGLKAINGEYIKIITDVLAASQRYMRKRKDECSFVSLRDVERCMQAFMW
FFENHVMFFTELEEFEKKQRGLTKEVHQRERKVRDPVLWSLIMAAGVCYHACLENKDEYR
QEFCKKNECTPLRVMQEISFMQDLLLSGVPMGETIAKNSALKENVFMMVLCIELRIPLFL
VGKPGSSKSLSKTLVADAMQGQAAHSELFKKFKQIHLVSFQCSPHSTPEGIIKTFKQCGR
FQVGKNLDEYISVVVLDEIGLAEDSPKMPLKTLHPLLEEGCIDDEPLPHKRVGFIGISNW
ALDPAKMNRGIFVSRGDPDEKELIESAKGICSSDAILLEEVRDLFKPFALAYLDVCQKQG
KGFFGLRDYYSLVKMIFAITKGTGKKPSEQKIVEAVLRNFSGKDNDVLTVFTAKLNMTPN
LDSIDVNDLVRQNILASGQEVECRYLLVLTKNYAALQILQQTFFSENKQPEIIFGSSFPK
DQEYTQICRNINRVKICMETGHTVILLNLQNLYESLYDALNQYYVYLGGQKYVDLGLGTH
RVKCRVHNDFRLIVIEEKEVVYKQFPIPLINRLEKHYLDIHTVLKKEQKSTVKKLETWVE
QFVSLNKHTVGPQGYKYQAPDVFIGYHSDTCASVILQVIEKSRQELETSEADILRASTLV
LLNCATPDSIVRLDCTMLPKVESERLSRVYFEEQNTSCLADFIIAHMKQDTHWHASFTEV
TTFSRLLTAPDLEQLEQLPHTVELLSLQQFETEQSFLKKIRTQNEGNNDSGNKILIIQSD
FESHSAHLVASAKYSSLNEITKIKKNTVENNIFVYFITKLPRMEGGTSYVGFYGGPWKSV
HIDDLRKSKDIASDIKALRNLTISELFDENRTQSKAMEHDDMEYSDASQNITEVQNQVVS
NLLYKCIQGHGQMTNNIAGWDFVLDTTALLRSCVQSAVGMLRDQVENGYRSTKRVEILLT
LLNDNEDFRGKFLRIVKRRLQSLLLTQNCNPHLLIKSNWVIKESSNIDAIQEGGTFRHTL
WKRVQAVVIPYLAQLISIIDRDQNLDILVDCNEPLKTLWLDIFGKEKLLDVPSLTIDLSH
SSAARTILVQNCFAVDKNISCSMPFSWRLRDYLEELWVYALQHEGQTQSQFDELFWKTHF
GQSIAKASLEMQSDFFQRYLQDFISMTMNVRSQENLQVVVCALNCCVNEMQSRTMETHKE
GTSLPWVHAAYYEFKNRLQNFARMINLEPRITQVLLNKHAQEREELFLPHSKVLDIYAAI
ACVEFLESTQLETDGQRQAWLRQVKKLHVPIELICSHGSVMHYGDKSKTMVCIVQTGWNR
IFTMSLFVEHLLLGDEEAEMNLNPLVLEHMRILGQTLKKNSDLKKQQAFEEVIVVLKACK
DKVVQSNFRFGLQLCPVCKVDPQDPLSLPCDHIYCSTCIKQWLVPGQMYCPLCMQAVPEN
FSTTSSEEIRIQFNQHAKFRTQCNAFFIDLVSTMCFKDNTPPCSSIIHYLLSLVMLEADP
LPIFRGDRHILTKVLSPFDESVDKNPVVRSFVLKLLLKFSFEDVKGYLQQHLTEVEQSII
LEKTDKTELYSMYINCLEDSMFERRQFSCVAEQQAYLQDERVFLSSCTRAACPDSATVEY
LQQVARVRMGLDMAATLLVQQMEGGAQSEGQASIKDFLATVMALCSQSNNDWFRVYLIRK
IGKEHGVEFVQSLLKVEGVHWVFPKEVLQKSEEGSPIDHFLVCGEDYKTIRDALDTVLIE
GKVDVLDKAYETCKCLPQKKAVYLLLALFREVTSLYGNANGIHHPKPEQCRVLVTHIDAC
GLLVTAESKDFAKALVANRLGALAVVPGAPGGHSVVLELTVHMASVLLCANQRILIPLQN
LALSTGNMRQAFLPTMPEDMLFVAQQAMGRVSWYYCPNKHPCAIGECGRPWVKSNCPDCG
AEIGGTNHIPVAGFTLPVPSPRGDRTQRGHVLGDPERRDNPDTLDTKNMSPGPFTLMRML
THMAMLYGAIINQQLVAQIIRPPVADPGAFLLAHLLKDMEHLTKSLGKGTDDTIHTVHLL
LCSLLEPHRPQRGPDPYDDHLSTKDHRDGWEKSASNTIIIPQLKHLDRRLKEANDLVRAD
ARVSRDPVFRLMFCDPHLFLASLPLSLIHGQAVWSCRKELSLQGLTHIVEQHDGKDSLPL
LWRFLQREAQLRFVKFLPDILTLQKDLVKKFQNISDLPFRTIADFLNSQQGAQISRRDWY
KRGITIVLTTWNQLRVSLATNGEIKIPAELCEEDLDLNSDFRLLLPQRQGPGLCSTALVS
YLIALHNEIITCVDKHTGEQTRWGRCWHTQRACFAAGRLSMPSYCEACQQGSCTLENHTV
LMYIILKDVKGKVEQEALQSRPASRLAAELRSYSEVCEALTALEVALGFLAMTGGDPDML
LSCYLEEVLQMKEQTAPQVLKALAVCRLRHCVALWQLLTSLKSQNMMRLKGDPFTAFPEK
YKLPLSDEDRRLLSGFIVKTVADGFLLEMHEFLLLKLKNPNAPEEYRPDWGLRDTVVSYM
ERKDLDVSPEVEDLFPEEICLSHYIEAWKFSVVFKQENSSQ
Download sequence
Identical sequences ENSGMOP00000006153 ENSGMOP00000006153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]