SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000006222 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000006222
Domain Number 1 Region: 360-571
Classification Level Classification E-value
Superfamily Kelch motif 5.23e-47
Family Kelch motif 0.00023
Further Details:      
 
Domain Number 2 Region: 12-129
Classification Level Classification E-value
Superfamily POZ domain 9.42e-34
Family BTB/POZ domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000006222   Gene: ENSGMOG00000005838   Transcript: ENSGMOT00000006400
Sequence length 612
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_293:512692:539161:1 gene:ENSGMOG00000005838 transcript:ENSGMOT00000006400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGNMLTGQRFCHSKAHQDSVLSALNQQRKDGLLCDVTLVAGEQKFHAHKAVLAACSDYFR
AMFSLCMLESEADEVTLQGVTGVGLEHALDFAYTGQIMLDPVVIQDVLSAGSHLQLLELL
SLCSHYLIQELSKVNYLELYRVADLFHLPALEEAVVGFLVDHLSELSRTRPDEALQLPYR
LLREVLRSDRLTSLSEEEIWKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXA
CRYDLRGDRWTEIAPMKACREHFVLGALGQYLYAVGGRNELRQVLPSVERYCPRRNKWST
VQSFDRSLSCHAGCVADGLLWVSGGVTNTAQYQNRLMVYDPEQNQWRSRSPMLQRRVYHV
MAPVRRRLYVLGGNDLDYNNDRVLVRHIDSYSVDADQWTRCSFSLLTGQNESGVAVHDDR
IYVVGGYSIWTNEPLACIQVLNVSTEGKEEVFYGPTLPFASNGIATCFLPAPYSTCPNLQ
MLQVPHHRIGTL
Download sequence
Identical sequences ENSGMOP00000006222 ENSGMOP00000006222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]