SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000006232 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000006232
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily POZ domain 5.16e-31
Family BTB/POZ domain 0.001
Further Details:      
 
Domain Number 2 Region: 358-451
Classification Level Classification E-value
Superfamily Kelch motif 4.71e-28
Family Kelch motif 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000006232   Gene: ENSGMOG00000005864   Transcript: ENSGMOT00000006413
Sequence length 452
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1039:38189:42672:1 gene:ENSGMOG00000005864 transcript:ENSGMOT00000006413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FNELRLEGKLCDVVLEVEGLQFKAHKNILCGCSPYFRVLFTHNMSPMTGVYPIPGVSADT
MQLLIEYAYTRHVEVTWDNVEALLVAADYLSVMGAVRACCGFLGGQLSVENAVGIWRLTN
HYPLPRLRRRAYLYILRCFEEVARVSEEFPELSLEQLGDLLGEDTLNAAQEEVVFEALLR
WISHAHEERRGHISQLLLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAMG
GYDGHTRLSSLERYQPEENQWTPLASMHEQRSDASATSLHDKVYICGGYNGSMCLQSSEC
YDPRTDQWTLITPMGVQRSGVGVVAYKDHVYA
Download sequence
Identical sequences ENSGMOP00000006232 ENSGMOP00000006232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]