SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000006245 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000006245
Domain Number 1 Region: 210-398
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 7.63e-31
Family Phospholipase D 0.022
Further Details:      
 
Domain Number 2 Region: 100-170
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.00000000000000197
Family Polyphosphate kinase C-terminal domain 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000006245   Gene: ENSGMOG00000005860   Transcript: ENSGMOT00000006426
Sequence length 409
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_4069:376409:387985:1 gene:ENSGMOG00000005860 transcript:ENSGMOT00000006426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGEPCSADCSVRLVESVPVGLYPYPPAPPSVSEGWLRLLGRASGSLSIAGFYVTLRDXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGAEVREVDLQAVTGGILHTKLW
VVDTQHLYLGSANMDWRSLSQVKEVGVSVEDCSCLAQDAARIFGVYWGLGAEKNVSLPPY
WPARLSALSSAQQPLNLSLNGVPARVYLSSAPPQISARGRTDDLWAILSVISDARRFVHI
SVMDFLPTSQFSVPGRFWPAIDSALREAACMRGVEVRLLVSCWPQSPPAMFVFLQSLSVL
GRPPLGCRVHVKVFTVPSTPEQMKIPYARVNHAKYMVTDRVAYIGTSNWSENYFVQTAGV
GLVVNQTGSAVGPGQATLQAQLDGVFNRDWTSSYTSALPDDRTDVCPCS
Download sequence
Identical sequences ENSGMOP00000006245 ENSGMOP00000006245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]