SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000006469 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000006469
Domain Number 1 Region: 71-345
Classification Level Classification E-value
Superfamily L domain-like 2.89e-51
Family Ngr ectodomain-like 0.0026
Further Details:      
 
Domain Number 2 Region: 394-466
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000013
Family Fibronectin type III 0.0048
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000006469
Domain Number - Region: 19-63
Classification Level Classification E-value
Superfamily L domain-like 0.00323
Family Ngr ectodomain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000006469   Gene: ENSGMOG00000006113   Transcript: ENSGMOT00000006660
Sequence length 584
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_2546:340804:342642:1 gene:ENSGMOG00000006113 transcript:ENSGMOT00000006660 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRPWIPILLGLHLQFSRASNCPEECRCDRTFVYCNERSLTSVPFGIGEGYKTLYLHNNQI
NNAGFPLELHHVASVETVYLYGNQLDEFPINLPKNVRVLHLQENNIQTISRAALAQLLWL
EELHLDDNSISTVGVEEGAFREALSLKMLFLTKNHLSSVPIGLPEDLKELRLDENRIAVI
VEEAFRNVTRLERLLLDGNLLTDEGIAPGTFQDLVTLRELSLARNSLTYPPPFLPGEVLV
KLNFQENQINIIPVGAFAGLHKLEKLDISSNQLQSLTQGVFDSLVSLRQLTVRNNLWLCD
CSIQWVVWWLKSLPGSLNVRGFMCQKPEKVRGMVIRELSGELLQCPMTTTTPLSSSSGGS
VGPLPASSTPDAPLVSQQGGTRTKRPLDPKRESLQVTFTILNGSAIHVNWVAAFPVTAYK
VTWARMGPSLTGDTVRERMVGGDHRGIRLPNLEPKSTYRICVIPLDAFNNYRPKDDTKCT
EVATTTATLGPNNKGPVGPEQATQPDPSSPFLLAGLIGGAVIVVLVLLLSIFCWHMHKKS
RSKSSADWKYNRGRRKDDYCEAGTKKDNSILEMTETSFQIVSLN
Download sequence
Identical sequences ENSGMOP00000006469 ENSGMOP00000006469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]