SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000006739 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000006739
Domain Number 1 Region: 21-169
Classification Level Classification E-value
Superfamily EF-hand 1.82e-47
Family Calmodulin-like 0.00000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000006739   Gene: ENSGMOG00000006349   Transcript: ENSGMOT00000006934
Sequence length 173
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_3590:2432881:2434165:-1 gene:ENSGMOG00000006349 transcript:ENSGMOT00000006934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATSAKRPSLQGPVPPPRKKTSPKPELTEELKQEIREAFELFDTDGSGHIDVKELKVAMRA
LGFEPKKEEIKKMTSDVDKEGTGKISFSDFLSVMTQKMAEKDSKEEILKAFRLFDDDETG
KISFRNLKRVAKELGENLTDEELQEMIDEADRDGDGEVNQQEFLRIMKKTSLY
Download sequence
Identical sequences ENSGMOP00000006739 ENSGMOP00000006739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]