SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007129 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007129
Domain Number 1 Region: 243-342
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.75e-31
Family Ras-binding domain, RBD 0.0031
Further Details:      
 
Domain Number 2 Region: 378-490
Classification Level Classification E-value
Superfamily PH domain-like 7.67e-17
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007129   Gene: ENSGMOG00000006687   Transcript: ENSGMOT00000007333
Sequence length 639
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4558:240:122241:1 gene:ENSGMOG00000006687 transcript:ENSGMOT00000007333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLDDGRPDRPGQQKAPLRQESNMANLSYRFSVYNINEALNQREGVDLDSLMADLCSIEQE
LTTDSSKTSRLGLTDTKVRQKPPAGRSVSPAGTVRGPNPTHWRPPLASNFSLEDITAQLE
KXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXARLVAHSSRSSVASASGASVN
SASSMDSLDRVLRFAPSDPKHSYLDSETSLILKNMAGKPSHLLTKEEQAAKLKAEKIRVA
LEKIKEAQVKKLVIRVHLSDESSKTMMVDERQTVRQVLDNLLDKSHCGFSPDWSLVETIH
ELQMERVFEDHENLVENLLNWTRDGQNRLMFTERMEKYAVFKNPQXXXXXXXXXXXXXXX
XXXXXXXCQECFGGGSVSVPEMEGVLWLKEDGKKSWKKRYFLLRASGIYYVPKGKASLQA
SRDLVCFLQLHHVNIYYGQDYRSKYKAPSDYCLVLKHPQIQKKSQYIKYLCCDDVRTLQQ
WVNSIRIAKYGKQLYLNFQEVTRRSDAAYDWSSLSSSSIQSGSSNSSMPESQSNHSSQSD
SGVSEMTSSCHARSQGVVSSIFSDAWRRGERHAPLASPSLPAAAPPGLALQPHFLEDLNR
TLKRKSVSRHGVLAAAGLLPAPSKTEPMGTVDDLALLPP
Download sequence
Identical sequences ENSGMOP00000007129 ENSGMOP00000007129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]