SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007913 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007913
Domain Number 1 Region: 175-306
Classification Level Classification E-value
Superfamily PH domain-like 1.91e-27
Family Pleckstrin-homology domain (PH domain) 0.00024
Further Details:      
 
Domain Number 2 Region: 357-457
Classification Level Classification E-value
Superfamily SH2 domain 1.09e-22
Family SH2 domain 0.0000385
Further Details:      
 
Domain Number 3 Region: 33-90
Classification Level Classification E-value
Superfamily Phenylalanine zipper 1.1e-18
Family Adapter protein APS, dimerisation domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007913   Gene: ENSGMOG00000007400   Transcript: ENSGMOT00000008143
Sequence length 515
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1288:689818:715186:1 gene:ENSGMOG00000007400 transcript:ENSGMOT00000008143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGNTVHPANTTTTTATPGGGEGGGLGLAAPPRGWREFCELHAIATARELARHYGSFARE
QPPQDAITPETFSKQFTQLFQQHFCYEVGKDGTPLGDYREARRLSGASLFAVLPPKAEAQ
APIREQELPLRCSAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPPAPTLKP
RPQPRSAGKEGQLRYLLVEDTISDTSPLWQRCRLLVRRTRDTHGGGGERYQLELYDPPKA
SSPKLSARCSDILQVRRCNRLEMPDNLNTFVLKVSHYPGSLIFETENDQQVSSWTTELKE
CISNRSGSLDQEPLPSPSDNSVPANHRGNTDTGSHGPLTFALPGLLYHKTDHFLCPYPWF
HGHIPRVKAAHLVQNSGLEGHGVFLVRQSETRKGEYVLTFNYRGKAKHLRLSLTELGQCR
VQHLHFHSVMDMLSHFRVWPIPLECGAACDVRLSSFVVAGCRPAQQGQVSGVVLVPFSLH
RWSSEPSLAHCSLARSPSLPSTVLNATTTAAPAAP
Download sequence
Identical sequences ENSGMOP00000007913 ENSGMOP00000007913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]