SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000008004 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000008004
Domain Number 1 Region: 369-620
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-35
Family YWTD domain 0.000028
Further Details:      
 
Domain Number 2 Region: 281-363,615-663
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000204
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 3 Region: 244-279
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 4 Region: 113-154
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000929
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 5 Region: 40-70
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000038
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 73-110
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000864
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 7 Region: 1-31
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000131
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 8 Region: 163-193
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000196
Family LDL receptor-like module 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000008004
Domain Number - Region: 701-801
Classification Level Classification E-value
Superfamily YWTD domain 0.000119
Family YWTD domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000008004   Gene: ENSGMOG00000007450   Transcript: ENSGMOT00000008234
Sequence length 801
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_2538:38484:45949:1 gene:ENSGMOG00000007450 transcript:ENSGMOT00000008234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQCAHGKKCIDLGQVCDGQPQCQDHSDEQQCSEAGKGCAHQCKDKSRCLPKTFLCDGESD
CVDGSDEDNCAPIKCSLGAKPCHDGTDCVLYSHICDGELDCKDGSDEDECSTTCQTSPTT
PAQFQCAHGKKCIEKEQVCDGVSQCQDRSDELECGKRSEGCVHQCDDQSRCLPKSFLCDG
ERDCLDGGDEANCEDKQECSNSEFRCASGQCVAESAGLVQCVSAETGARVGGETSCHLHS
SDAATCPPNLFQCGSQECLALEQVCNGMTNCADGSDEGGACLTRCTEQDFARCSHMCHST
PQGTRCHCTPGFKLAEDGDTCVDIDECAAVNECSHLCVNTPGSFQCQCPPGYVLQADGRH
CKITGKTDLILFGLRSGSLDVLPSTAKKAILSLDYDWREQKVFWASLDSESIRWSSLDQK
TKGTLIKGHTHTTHSVAVDWLGRNLYWIDGVKSEIVAVRLNTATAKAPDYSVILDEDMDQ
PRSLTLLPQKGLMFWTEIGNVAKIERAGMDGSARRELVNTSLGWPGGIAVDTMCNRVYWT
DERLKAIGSANLDGEDIQILQMKETTNPFSLAVFNDLLYWSDAKRRVLQVAQKGTGRNYQ
ILLKRPKQPFDVKIIHSLLQMGAENPCEKTHCSHLCVLAPGFKAVCKCPSGLLLAEDGFT
CSKLKNSAFLLLLSPSTVTRARHAAVELKQWPEHQALPLYNVNEATMLDYSLREQALLLT
DTGTTSLGLFKLQDGNLSPRGQLLKLLGGTITAMALDWLTLNVYWSSTKQPRLQVTSFDG
AHTAVLVKEAVGTLESLAVHP
Download sequence
Identical sequences ENSGMOP00000008004 ENSGMOP00000008004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]