SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000008599 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000008599
Domain Number 1 Region: 128-201
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.38e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.001
Further Details:      
 
Domain Number 2 Region: 270-330
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.99e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0017
Further Details:      
 
Domain Number 3 Region: 420-460
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000326
Family Pleckstrin-homology domain (PH domain) 0.00023
Further Details:      
 
Domain Number 4 Region: 575-677
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000979
Family Protein kinases, catalytic subunit 0.011
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000008599
Domain Number - Region: 796-833
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00279
Family Protein kinases, catalytic subunit 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000008599   Gene: ENSGMOG00000008026   Transcript: ENSGMOT00000008840
Sequence length 890
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1831:48:26174:-1 gene:ENSGMOG00000008026 transcript:ENSGMOT00000008840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPRGPSPLGSEVMQQGVPMSVPAQGGCPPMDLGAGDGGRGPGWATMPPGPPVPAGVSFII
QIGLTRESVLLPQAADLAYVKQVACSIVDTKFPECGFYGIYDKILLFKHDTTTHNILQLV
KAASDIQEGELVEVVLSAAATFEDFQIRPHALNVHSYRAPAFCDHCGEMLFGLVRQGLKC
DGCGLNYHKRCAFSIPNNCSGARKRRLSTTSLTSSQSLRLSASESLSSVATASNRAEEAS
LVRSHTQMVGPRTPSEARRFYTGRPVHLDKMLMSKVKVPHTFTVHSYTRPTVCQYCKRLL
RGLFRQGLQCKDCKFNCHKRCAYKVPNDCLGETAGDTLSPSVDAEVPMDYSSSYDCSDKL
SMDDSDEVCSIPGSFSPESNPDGVSGDQXXXXXXPPSVYIPLMRVVQSVRQTTRRSSTSI
KEGWMVHYSNKDTLRKRHFWRLDCKCIILFQNNTSNKYYKXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGVGREVARAWEGVIRQALMPVIFQDAPPP
KNTPHRQASVSISVSNSVIQENVDIGMVYQIFADEVLGSGQFGVVXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXSLRHLGIVNLESMFETPEKVFVVMEKLHGDMLEMILS
SEKGRLPERLTKFLITQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXIDLINNLLQVKMRKRYSVDKSLSHSYLQDYHTWLDLRELE
TKLCERYITHESDDTRWQLFARENTLPYPAHLEDAEDGDMQGLTERVSIL
Download sequence
Identical sequences ENSGMOP00000008599 ENSGMOP00000008599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]