SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000008732 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000008732
Domain Number 1 Region: 3005-3166
Classification Level Classification E-value
Superfamily SPOC domain-like 5.1e-61
Family SPOC domain 0.000000131
Further Details:      
 
Domain Number 2 Region: 433-587
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.43e-30
Family Canonical RBD 0.0027
Further Details:      
 
Domain Number 3 Region: 5-91,329-411
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 9.51e-21
Family Canonical RBD 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000008732   Gene: ENSGMOG00000008156   Transcript: ENSGMOT00000008977
Sequence length 3167
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_168:1650711:1666586:1 gene:ENSGMOG00000008156 transcript:ENSGMOT00000008977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRETRHLWVGNLPEHVREEKIVEHFKRYGRVESVKVLRKRGSEGGVAAFVDFVDIKSAQ
KAHNAVNKMGDRDLRTDYNEPGSVPSAVRGLEDNPPSSSRDVTGFSRGTVGPVFGPPLSL
HTREGRYERRIDGTSETRERAYDHSPYGHHERSGTFDRPRHYNPDYYRDRTMFAATGPGS
SAMGPGFEATDPHFESRIRDPFTLTSTARRDLYRDDRGRRVDRTYHHRRSRSSHSSQSRH
PSPQRSTGQAPKAPHSPKRAPLSPGRGPHSRSRSRSSSSDSVSSTSSTGSGSSDSNSSSS
DGSRARSVQSSAAHAPPQSSMGLDSEEPRRSFGIKVQNLPVRSTDTSLKDGLFHEFKKHG
KVTSVQIHGATEDRYGLVFFRQQEDQEKALTVSKGKLFFGMLIEVTAWNGPETESENEFR
PLDGRIDEFHPKATRTLFIGNLEKTTSYQQLLDIFQRFGEIVDIDIKKVNGVPQYAFVQY
SDIASVCKAIKKMDGEYLGSNRLKLGFGKSMPTTCVWLDGLASNITEQYLTRHFCRYGHV
VKVLFDRLKGMALILYNNTDFAQAAVRETKGWKIGGNKIKVDFASQESQMAFYRSMQSSG
QDIRDFYEIPTERREERRPPYHEFTAERAYYESVRTPGLYPEDARREYPARSRERFPDLE
HFPGEPFDPRFHEDPREYRDFRDPFEQDIRKYTYIQRERERERERFEADRGRWSPSHPRR
PITPTVSPSPSERAHRDSERRVYSQSSERSGSASSLSPPHFEKSDKTPLEHGSKGDKTGQ
ADRLASAEKGKRARRKDKAEKDKGDKPKSRKPKAQSPCDPSLEAEPEAGFDVTSERGTGS
VQDATERPKFKVESDPLSSNPLPTVTPAETIKSERTELAVGDSDGDGKSRGKKHIKSESV
NDVKELTVDSDRLAARKRRFADASGRPIRHKRSRLDDEDGNHPDISASSATLKDIDGDKQ
HKDSERRDSRIKIEKHAFLGIQKEGQEEASGPRDPSEALVDVLDSKQHQGHNASRRFSHE
GHMDQGSTRDPELPGFKYQTDDVEKGTKDREEHVDIDHSQSYRKQMEQNRRLLQQQQQQD
FDKSDKPDSPLGGEMDDLDHRSLVHEVGKPPEDVTDTFPSHKVNKKIDQFDNDASIKKER
VYRVSRLKTEEPDWSNTASPGFHHSPHHPDEASLEQPQPKEPSISDDKIHSDLELSLKQT
HTTHTNKPNTPSLSIEEEQQKRWESRVKQDILPDLNFSRSISKNIHNRKREDGVWHDLEP
GEVRSDSEEDKEHKPHSPMPSPSMPFSERLRVDRISDPKVANLERNKFYSFSKTITSDTQ
ALLDRAKSLSSSRDENWSFLDYESTLAGLPTRKDTEKVESTPLPKPLWYMKKKKIRSGSE
DKLDDRKEEPKPEQERRELFASRFLHSSIFEQDSRRLKHLERKHEEPEHGLNAQAAQQGT
PDDSEPAVLFRSRFLELTRSQQKNKFNQGPKIEKAPEPQPQALPSPKMSEPAVEPEIKPI
SPTEPRPLPIIISQSTPNEISPIEEKCVVVSPPLEPSAPLSLIKEEKENLEPTHHTPTEV
PKDANIQILAIPESSHPVQKQAIPQEKADIIGDVQPQCMEKPSNSDAQEEFVSCSEPEMD
LETSQMDMSDAISPRVPTLVEDIESLNVLKPMTRKTHFQSIMVLPDTDEHEEDISPQKEQ
RGRELKSRKHKQSPVHVSPVAASSASNSEKLATRKSERIDKEKLKRGSSPRGDSKSSAKS
PISATDSDTPDHPPSRTRVRRNVKSVYATPVEDDASVRTGKEIPESPRSGRKRAGDKDAT
IQHNAEQEPKRGRPRKQTEDGSASKGDRSKSDAKENDSNESESGEKIPKMTKGKHSPEIE
SMDEEPMALEESSPLEDPLKVNPKKEDQDQQGKEVCKDENAVLGRKNNKKKSASPVSEEK
VPFEKDKVAKGKTKLTRAPKSPVLKNLKISLNVTEVKNLLQLGDEENSNQEDPSKRLGDH
TDPPSEPNSSSKVPGDGDGDEAASEKTPQDAAKSFLTQELELAQAVENIAKLTGSALPAK
PPTPPIVPPEIKSDPEDQKPSNPASETELMAAIDSITAEDIAAALPPTAPLMDVDSEPEL
QVVIPPEKDDETEMETSALPEIPSATPKKGTKGRPKQKAQKPVKKDAKERQSVPEESPCP
SSDSTASKLKTLPEVTPSSATAAVITATTWKPEPESSLNKASEDKAKTESSSIEQLPELK
SVCPQSKSPIGPKPPQQLPENISPSLSPSPSRPNIRPIQPNRMPVSPPDWHNTPKDIAVA
LAPVLPATALVNHPNQSLTPEPENMDTDHGTSDLRQILMKPKNIPRQGSSTITSNLPTPR
DKPSEPTTQSSAMLNKCPLPDHRMLTPAQPVVRQPASLLSPESKSVISVIASTATSVISR
VCNPPETEEKINMTAGNPCADIAVSKQTYRPSIDDGGSYQGPSVGEEGGSAGRFIVESTN
LSTGSSPGLRVNTSEGVVVLSHSGQKTEGPQRISAKISQIPQATAVDIESQQLVSMPQIK
QELYSHSQTGAQKGPPILSEHGHSGKTQSASIKQENTGLEKMDSVYQSGPQGVVKRLPQA
GGNQQGMNYHHPEYVLMKHQKKVEATDSHSADVAKTSWPSAISPAISPHLPSPPGNHVGF
VTSTSGAPSHLGGAKPEPRSPRNPHSPFPKVSSPIGSSSPKGIPVMLPSGIAPMQQYVHH
PEQSVIMPPHSSHGGLGRMSPHRVTSASMAHLVQDVRVNTPPLSVMNFGIHGEPQGSPWS
GSLQQRPTSPQAVSRDMVLKVNPGLVRSHEGEQEEARRFHQMAGRQSVTQLKAESIQAVP
TRLPLDTYMAPRDMPRHIHLQGERTAPDQHGGHIQDSLPPSSTSSNIPLSLSPRAHVLKG
VSEKDVAKSLESKRPHSPHAKDSVMGIRPPSSAIASPQRGQLIPPASSGSFNEYAGMYVN
PRSSHQQMAETSPVTIMPAMVCSRHVFLNKSLIPQGTDQQAKQDGKMTQPVNMVQLLTVF
FFFSSQKYPIVWQGLLALKNDTAAVQLHFVCGNKALAHRSLPLQEGGALLRIVQRMRLEA
SQLESVARRMTGDSDFCLLLALPCGRDQEDVLNQTQALKAAFINYLQAKLAAGIINIPNP
GSNQPAYVLQIFPPCEFSESHLSQLAPDLLNRISSISPHLMIVITSV
Download sequence
Identical sequences ENSGMOP00000008732 ENSGMOP00000008732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]