SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000008988 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000008988
Domain Number 1 Region: 3215-3382
Classification Level Classification E-value
Superfamily SPOC domain-like 1.96e-61
Family SPOC domain 0.0000000973
Further Details:      
 
Domain Number 2 Region: 437-591
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.76e-29
Family Canonical RBD 0.0033
Further Details:      
 
Domain Number 3 Region: 5-91,333-414
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.28e-20
Family Canonical RBD 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000008988   Gene: ENSGMOG00000008397   Transcript: ENSGMOT00000009234
Sequence length 3383
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1125:245879:268831:-1 gene:ENSGMOG00000008397 transcript:ENSGMOT00000009234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRETRHLWVGNLPENVREEKIIEHFKRYGRVESVKVLPKRGSEGGVAAFVDFVDIKSAQ
KAHNAINKMGDRDLRTDYNEPGTIPSAARGLDDSLSLGSRARDVSGFTRAAGGQVYVPPA
SLHNRDGRYERRLDGTGESRERAYDHGTYGHHDRAGSGSFERQRHYEADYYRDARDRTLG
TSGAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDRGRHVERTYRQ
SRSRSRSAHSRNPSPERLAGQTAGLARSGGQTLGSRSRSSSSDSMSSDSSSTSGSSDSST
SSSDDSPARSVQSAAVPAPSALALSSLDKDEPRKSFGIKVQNLPVRSTDTSLKDGLFHEF
KKHGKVTSVQIHGASEERYGLVFFRQQEDQEKAQGASKGKLFFGMQIEVVAWNGPETESE
NEFRPLDERIDEFHPKATRTLFIGNLEKTTSYHDLLNIFQRFGEIVDIDIKKVNGAPQYA
FLQYCDIASVCKAIKKMDGEYLGSNRLKLGFGKSMPTTCVWLDGLASNTTEQFLTRHFCR
YGHVAKVVFDRMKGMALILYNNIEYAQAAVKEAKGWKIGGNKVKVDFANQESQMAFYRSM
QASGQDIRDFYDLLTDRRDERRSQYEFSAERTYYDNVRTSTTYTEDPRRKYPTRSREFYG
EWDPYQGDYYDPQYFEDPREYREYRADPYEQDIRKYSYLQRERERERERFETDHGRDHGR
RTIERSQSPAHIPPHRLASPTASPSLSERIQSDSERRLCCRSSERSGSCSSVSPPRFEKP
DKTHAERYNKLDKLEKDRTFDVERGNVSDKEKRVGRKDKVDKQMLKKLKASSPNPRGEPE
VERDVCPVAAFQSKSIKTQKEACGKVKVDILPCVVQLTRVKESKEGKTIGHAAPEKRRPK
GESDSHPLASPSEEQRSPSCTTEFSKGDIPKLGKVEKKTLSSVIDVVEKDAKLKTKKLGK
SEAGFDSLSVDIDRLAARKRRFEDSVGKPNRQKRHAEKEDNRQETCLVGDSSQELIDEKS
LVLKRIHKRDHSKDNCEHIVSVYSPKDRKDSETNSIGLTLELQSRLGSLHEYSMDSLEKS
YVQMECGLSKGQSSSILTKLFDDSNSDAEYKEQKPGSLETADSIVQYKETTECNKDLVSH
FEQMKRCKKQTESSSWLGPKVVKPDTFAKSQSPPCNEAYDFEKDCMPCDLRKSDLNEGNV
SSSKRKKLEQSDTEVFSPESEPNICSPPHLHEAVQQNITSLSASQVSTREEEGGAQISLS
FIKKEQRSSPIADESLKYNLDLTTRDFQSTDTEFSKLKSALLGCDKELLHRWERKIKSDS
VRMEMTSPTSIVKHDNTCKLAEVQSDSDEYSEGKNDLPSTNASLSYILREREDKCPDHKL
SGSLEKNKFYSFALDKTITPDTKALLERAKTLYSSREENWSFLPTCFPSTDSCSDKEKVE
LAPRPIPSWYMKKKKIRTNSEGKLCDKKDELKPQEQERKELFASRFLHSSIFEQDSLRLQ
RLERKDQDIQTGASKPLAKLSTTELQPVSGSVNIPQEPKVLFHSRFLELQQQKDKDHPAH
DAENVPIEIKAELPNGNNDLCVIASDQVHKMNTESVHSVVETSPPLMKDSKAPEEDEEEH
ILDSSQPQSPLKDVNSVVTKLPENSPLALSEPEFQGGKSDFKSKLKIGSGGDHKTPTSGS
SLSSFDGETPEFRLTESITTEPKTGDEESKHCKESETNIYLLNLESDIKLLPKRKQPKNK
RARAAGSGLRSKRISQIPPSKKPVTRKSERIDKEKLKRASSPLEISKTSEGKNTPIQASD
LEQTLDSSLVQGRTRRRNVKSVYATLNEGEQAGKEVIEPLRSMRKRGSDKDQVQQDGPNQ
SVITRRGRPPKRGGRQGEEVSPVKEDQPKMMEQDVDLGVSSTSLEILKTSEEWCSPVTQK
VQQPQVKKASKIESSFAEESDSASNELLETKLEEDSVLSGKLSEKEKARKKDFDVHTTSE
EEMIRVDVTPSQIKPPEKITKIKTARLKRNAKQLTDEKSHNLKNLEIRVSVDDVKCLLRS
EENESVSFEAATITKIIPGLEDNKGTKSVSPQKETKENSSVEMEDLSETETPIDPSANLI
ARQMELEQAVQNIAKFSTGQQSQPLKEPPAETPSLPPTPLEPPNEVEVEKKALPACETEL
AAAIDSITSEDISAEPEGFTAPPRYTDVISTVISPATNEIRKPVKRLAFNKNLTADQAVA
PLTPAAKPVLSEMKAGPSTAASPATETVKKMGKVKTKTVKKPRSRKGVAIKINKTSKEVI
ETEASHSKGASVVTALATCRQDISSAMKVDTPKEAEQPVMEQPVPQESAFHLGTNKASSS
RKCVQAAKQPDLTIAPSPAPPIPVSQFIAPPLHHGKSITPDWLPKSEGSKMFGPHSPHAA
VVTLSEQAVTSLAGPQGNPALPPDTKASDTDPSSSTLRKILMEPKYVSALKNKDMPNTSL
TSVLSEPSPRMEKKNSLETVDSRHVHPEEPHHLSPQPQYPKPSPLTESRQNYGEKIQHTV
ISSPSTSVISRIPIPYDSEDTPRISLSNRNTGQSLPKQKFRTNSNENSRYHVLDTMNDVP
RGRSVVENTPYSTAASQGLRVNTSEGVVVLSYSGQKTEGPQRLRAKISPIPPASAGDIEF
QQSVSKSHIKQEPIPPSCQPSTPKGPPTPTIYGHTRGLLSGQSYNSQPVIASTKQENQRP
EKYEVPYPTGSQGGVVKMFQPSGASSQVLMYNQAVIQSHGHTHGNRGPGTESAPKKMDMS
RPAPHSNLSPRMSPHHTSLSSTCRSPGSGIPPDRPAPLMKQEPQSPRSIVKSPSPFVKAC
PPSSSPIGTSALGPCLSPLSPYSGMPHTHTEQSSVIMPPHNVANSMANEARLNTQPISAI
NYGRRSDSLPHELPPHHPSTPKSSVIRDMALQSHLGPQGVVSGGINSSGSEEDRRHFNQG
LPRPPVPQIQPDVIMMKNDQRSLRLDQYRDMHQRILLHQELGEQAAVDARQARPSELSTI
SPVSISAPSIRPFMGNNTTSTIKESPKALEGKNVHPSRTESRIMGGHASRPVMGSSLPQG
VQRMHPGAAGSFPVYRDMLGFPSQFPRRPSVGMNRANRGIVSSQLINQVHSENELGLRGK
VSHSHFGGMDSTSEGSHLRHGSSVDLSHASRMQREAVSPSYQSPMALPAGMPHKADSSLL
GPPAFLTTPPPTGLSIGAQRLHPEGKLEHSGHCSTDMVQLLKKYPIVWQGLLALKNDQAA
VQLHFVSGNEVLAQCSLPPPEGGSMLRIVQRMRLEASQLDSVARRMTVENDYCLLLALPC
GRDQEDVLSQTQALKTGFITYLQAKQAAGIINVPNPGSNQPAFVVQIFPPCEFSEVHLSH
LAPDLLNSISSISPHLMIVIASV
Download sequence
Identical sequences ENSGMOP00000008988 ENSGMOP00000008988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]