SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000009292 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000009292
Domain Number 1 Region: 83-358
Classification Level Classification E-value
Superfamily L domain-like 1.02e-50
Family Ngr ectodomain-like 0.0014
Further Details:      
 
Domain Number 2 Region: 422-495
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000326
Family Fibronectin type III 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000009292   Gene: ENSGMOG00000008687   Transcript: ENSGMOT00000009544
Sequence length 666
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_4249:90118:92311:1 gene:ENSGMOG00000008687 transcript:ENSGMOT00000009544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AELRDWLFLLLLCLTLLAEVLELAAAAIAMENGEGEEGAVCPSVCRCDEGFVYCNDRGLS
MIPPAPDAAILYLQSNRLSNAGLPPSLERSSSIRVVYLYANQLDEFPIHLPPSLKELHLQ
DNNIRTLPRSSLAKLPLLERLHLDDNSISTVSIQERAFSGTPKLRLLFLSRNHLSSIPAG
LPASLEELRLDDNRISTIPTHAFRGLSSLRRLVLDGNLLANTRIADDTFSRLSNLTELSL
VRNALLAPPVNLPSNQLMRLHLQDNGMTHVPRGALDAMRRLQRLDLSGNNLTSLPRGLLK
DMESLEMLLLRGNPWYCGCNLRWLHAWLHSRGAAVTVRGLTCQGPEAVHGKALRDLTGLM
EQCEGPPVGAGAGANPAEKGGGGGGGGVPTQGSLFTLRAKRPGLGMPLAPREGGQISGEA
LELNVKPLSPDSVLVTWLCPRPAPSFRLSWLRLGSSAALGSITETLVPGERQQYHLTQLT
PRSHYLICLLPLRQDPSTGKSSGPACAQIETGEAPVSGGGEGSDKEGQDTELTVLPLAGI
IGGATALVSLLLIFGIFCWYGQRAGYMSSDASSYSRGRGGKGYDDYVESGTKKDTSILEI
RAPPAGFQMTAMAHQPLQPKLEDVTYIHTIFPSSSSSSQGGHHPVGYGTNRGYREGGIPD
TDYAYT
Download sequence
Identical sequences ENSGMOP00000009292 ENSGMOP00000009292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]