SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000009433 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000009433
Domain Number 1 Region: 2-88
Classification Level Classification E-value
Superfamily Hormone receptor domain 4.05e-25
Family Hormone receptor domain 0.0001
Further Details:      
 
Domain Number 2 Region: 245-347
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000485
Family Rhodopsin-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000009433   Gene: ENSGMOG00000008818   Transcript: ENSGMOT00000009688
Sequence length 376
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_985:7920:57845:-1 gene:ENSGMOG00000008818 transcript:ENSGMOT00000009688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEPFCETSIDGIGTCWPRSKPGQMVSRPCPEMFYGVRYNTTNSVYRRCLSNGSWAVKGNY
SMCKAILYQEKRSKMHYQIAVIINFLGHCVSLVALLTAFCLFLCLRSIRCLRNIIHWNLI
AAFILRNATWFIVQLSMSPEVHESNVVWCRLVTASFNYFHSTNFFWMFGEGCYLHTAIVL
TYSTDRLRKWMFICIGWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXINFIFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEV
SQIVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAVRKRFHRWQEQHSIRARMTQAISIPT
SPSRVSFHSIKQSTSL
Download sequence
Identical sequences ENSGMOP00000009433 ENSGMOP00000009433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]