SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000009456 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000009456
Domain Number 1 Region: 278-561
Classification Level Classification E-value
Superfamily Kelch motif 7.85e-77
Family Kelch motif 0.0000124
Further Details:      
 
Domain Number 2 Region: 7-123
Classification Level Classification E-value
Superfamily POZ domain 6.67e-34
Family BTB/POZ domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000009456   Gene: ENSGMOG00000008834   Transcript: ENSGMOT00000009711
Sequence length 578
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_3616:67155:73115:-1 gene:ENSGMOG00000008834 transcript:ENSGMOT00000009711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDFMFVEATHPDKVLQGLNGIRLNNAFCDVTLCCGGQEFPCHRIVLAAISTYFQAMFSVD
LIESRQERVALNGLEPQMIGMLVSYAYTSKVFISKANVQGLLAAANLLDIMPVREACCRF
MERQMDETNCVGIHCFAEAHSCQTLEKRSMEYILANFKTVYQQEEFLSLCLDKLTQIIAS
DQLNVPQEEMVFEAAMLWLNKCSSRKQSFDKVLEHIRLPLISPYYLHDVIESLDVVREDQ
GCQRLISEAKDYLLLQDRRGELQCPRTRPRSSTGMVEVIITVGGEDDKVVLRSVETYDPI
LNQWKNLALLPFAISKHGLVVSGSTMYLAGGEFPDGSASREMWRYDSCFDSWLEMAHMNV
ARSELGLVMLDGFLFAMGGWEGRSRLDSMECYNPHNNTWQFMQSVKLGVTSPAVAALDGF
LYVTGGAVLEDGDGTDLTQVYNPKTAMWTEVAPMQIARSGSAACTLNGKIYVIGGWHAST
ENTDKVECYNPETNKWTKCAPMKERRYRPGVAVVEAHIYVLGGEEGWDRYHDTIERYCSK
TDTWEIVGEMPSSRSWLSCVTLPLRRDFQAKSMELTNT
Download sequence
Identical sequences ENSGMOP00000009456 ENSGMOP00000009456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]