SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010070 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010070
Domain Number 1 Region: 294-599
Classification Level Classification E-value
Superfamily Kelch motif 7.19e-44
Family Kelch motif 0.00074
Further Details:      
 
Domain Number 2 Region: 5-120
Classification Level Classification E-value
Superfamily POZ domain 8.63e-32
Family BTB/POZ domain 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000010070
Domain Number - Region: 202-285
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.085
Family Pyruvate oxidase and decarboxylase, middle domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010070   Gene: ENSGMOG00000009430   Transcript: ENSGMOT00000010341
Sequence length 616
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_355:63532:66011:-1 gene:ENSGMOG00000009430 transcript:ENSGMOT00000010341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRTAKHSLTLLSQLRKMRETENLTDVVLVAEGISFPCHRVVLSAFSPYFRVMFTCGLRE
CNNREILLRDTDAQSLALLINYMYTSELPLSNANVQEVSIAAFLLQMDDVFACCQLHMTD
NMDASNCLGVYFYARDLGAENLADQAQRFLRQNFLQVCQSEEMLELEAHQLGKLLSSDDL
NISREETILDVVLRWVRYSPLEDGRSHHLPELLRKVRLPLIDADYLREAMRRNTALLADA
ECTEMLNEALAVTAMHHSAAPRKLRLRYGMETTDLLLCIGTDSGGIRSRYGGYADRNFCY
APSTGRSYYITSPRYGEALGYVCAGVVTEENDIILAGEVGVRKMARQKERNVEIFRYKVE
AQGSWECLTSAEYRDSFALGSLGDTVYLLGGQMMLKNQQLITNSVERWCKQGGPWRSAAP
LPLPLAFHSAVTLKDRLYVIGGRTPQSHRIDDEPDRLSNRLLVYDPEWNKWAELSHMKYS
KYRCSAVVLNGEIYVMGGIGCEGLDGGQSRRCLDAVEIYSPDEDQWRDGPPLPSPQLSLR
SNASNAGVVGGKIYVCGYYKGADRHDDITKEVLELDPWENRWTAVARHALMHDNYDVCLV
AKLNPRGLMSPPADLV
Download sequence
Identical sequences ENSGMOP00000010070 ENSGMOP00000010070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]