SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010078 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010078
Domain Number 1 Region: 157-259
Classification Level Classification E-value
Superfamily Kelch motif 4.05e-27
Family Kelch motif 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010078   Gene: ENSGMOG00000009436   Transcript: ENSGMOT00000010349
Sequence length 259
Comment pep:novel genescaffold:gadMor1:GeneScaffold_384:640:4980:-1 gene:ENSGMOG00000009436 transcript:ENSGMOT00000010349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IGASFLQLQNVKDACCSFLQEHPKNCLGVRQFAETMMCTTLYDSANCFVHQHFAEVSLSE
EFLSLRGEELVELVGCDELNIKAEEQVFEAVLAWVRHDPKEREVLLPELLSKIRLPLCRP
QFLADRVQQEELVRCCHKCRDLVDEAKDFHLMPDRRPHLPAFKTRPRCCTSITGLIYAVG
GLNSSGDSLNIAEVFDPIGNFWERCQPMKTSRSRVGVTVVNGLLYAIGGFDGQSRLSTVE
VYNPETDTWARVSSMNSQR
Download sequence
Identical sequences ENSGMOP00000010078 ENSGMOP00000010078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]