SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010353 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010353
Domain Number 1 Region: 21-121
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000316
Family I set domains 0.061
Further Details:      
 
Domain Number 2 Region: 231-262
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000271
Family C1 set domains (antibody constant domain-like) 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010353   Gene: ENSGMOG00000009686   Transcript: ENSGMOT00000010635
Sequence length 264
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1633:30727:36689:-1 gene:ENSGMOG00000009686 transcript:ENSGMOT00000010635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWCKVLLLLSLLAVINTASPLQLSVALGSTVLLPCPLHQQQADLSLLRVTWTRGNGSEVA
SFGPAQQQHVQGGFLWNPPAFLRGNFSLTASDVPGPQGAYVCSVSYNSSRLGSHNVSLSV
LXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHPVDGAPAGPVGL
HRAIGNMTFYPSRDDQNATFGCEVTHGSVHRSLTFQLNFTXXXXXXXPVSSRSSALTLAC
DLDGFYPEEISVSWVQNGTTLPES
Download sequence
Identical sequences ENSGMOP00000010353 ENSGMOP00000010353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]