SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010754 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010754
Domain Number 1 Region: 2-329
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.8e-74
Family Calpain large subunit, catalytic domain (domain II) 0.00000178
Further Details:      
 
Domain Number 2 Region: 338-507
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 9.94e-38
Family Calpain large subunit, middle domain (domain III) 0.0000201
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000010754
Domain Number - Region: 531-600
Classification Level Classification E-value
Superfamily EF-hand 0.000941
Family Penta-EF-hand proteins 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010754   Gene: ENSGMOG00000010046   Transcript: ENSGMOT00000011052
Sequence length 600
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1868:7324:17510:-1 gene:ENSGMOG00000010046 transcript:ENSGMOT00000011052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSNENPIRFRNQVFRTLLDECLASGSLFSDPTFGADQNSIGLPEDPDPKRVIKWLRPKEV
GENAVFVEDSTGTTDICQGQLGNCWLLAALSCLTMHPKLFVKVVPPNQSLSTAYAGIFHF
RXXXXXXXXXXXXXXXXXXXXXXXXXXYYYTNEYWGALVEKAYAKLMGSYSSLRGGNISE
GMEDFTGGIAYSLPVASRTPRVLWRALAAALARRSLLSCFIQASHYSEVGKVTGNGLVKG
HAYAVTRSTKVRQGTGETLLFRLRNPWGFVEYKGPWSDXXXXXXXXXXXXXXXXXXXXXX
XXXXXISAEDFSQQFDTVELCSVNPQTLDPPGAAPSVWDITEHQGAWRRGSTAGGSRRYX
XSFWKNPQFNLVLSKQDQEEEEDSDDEDGRRTPEEKVALKQKEKGKRCTVLVELLQKHRR
KKTSVDFLYIAFHIYRVPPELVGMCLDQSFFKSNKPVGRSGKYRTQRAVWQKLNLAPGSY
VILASTYRPNIPGDFCLRIFSKTGNTLGSLDFTCSSSLLMQVMSEPVSRGDLVTVEMVFD
EKATPDDRLDAKEFMNLLNTGKNILYIATRWEDALFFRYDEDSSGAMSPFELDLALNAAG
Download sequence
Identical sequences ENSGMOP00000010754 ENSGMOP00000010754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]