SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010833 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010833
Domain Number 1 Region: 109-321
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.81e-51
Family DBL homology domain (DH-domain) 0.000094
Further Details:      
 
Domain Number 2 Region: 343-454
Classification Level Classification E-value
Superfamily PH domain-like 7.46e-16
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010833   Gene: ENSGMOG00000010126   Transcript: ENSGMOT00000011131
Sequence length 494
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_2190:3488:8525:1 gene:ENSGMOG00000010126 transcript:ENSGMOT00000011131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPLQRGSSFTFLTPGTPWDFSLKRKRKEKDDDTVSLSSFDLKEPSNKRVRPLVKVTSLAN
LMSPSKNGAVRRFGQTLQSMSSKSPGMSLRASSKGAGPTPTKRRNSTLWSESLDVHQKST
FSTKEIKRQEAIHELYRGEQDLIEDLQMARKAYHDPMLKLSIMTEEELAHIFGELDTYIP
LHEDLYAKLTESAAGPSGIVGQIGQIIIDWLPGLNSYKVYCSHQLAAKALLDQKKQDKRV
QDFLQRCLESPFSRKLDLWSFLDIPRSRLVKYPLLFREILRHTPAEHPDIASLEKAIAII
QGILSDINVQKGESECQYYIDKLEYLDDRQRDPLIDSCKSLSCHGELRNKSGSKLHVFLF
SELLVLTRPVTRNERSCFQVYRQPIPVRDLALEDLQDGDARMGGSFRGAFTNGEKAKNVF
RVSSLDPSHGQSHTLQVNDVYHKQQWLNCLRGAMALQPAGPPRVRTETTAGPVSSRRRSS
TVSLDNEEADENHC
Download sequence
Identical sequences ENSGMOP00000010833 ENSGMOP00000010833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]