SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010870 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010870
Domain Number 1 Region: 317-557
Classification Level Classification E-value
Superfamily Kelch motif 1.06e-54
Family Kelch motif 0.00019
Further Details:      
 
Domain Number 2 Region: 36-149
Classification Level Classification E-value
Superfamily POZ domain 1.1e-30
Family BTB/POZ domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010870   Gene: ENSGMOG00000010158   Transcript: ENSGMOT00000011168
Sequence length 573
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_2801:221123:226057:1 gene:ENSGMOG00000010158 transcript:ENSGMOT00000011168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HLLVSLSVFLLPLPSPHPSTMEPGAIKEELRLFQSTLLQDGLKELLNENKFVDCSLKVGD
RSFPCHRLIMAACSPYFREIFFGEDGKELEDTKEVVLEDINPGILDMVIRYLYSAEIDLT
DDNVQDIFALANRFQIPSVFTVCVNYLQKKLSLGNCLAIFRMGLVLSCPRLAVAARDYVA
DRFELLHDDEEFLQLAAHELFAVIGGDSLNVEREEMVFEFVMAWVRHDKDKRLPVLVDAF
DCIRFRLMPEKYFKEKVEADEIVKASPELQKKIQAVSDAFKGKLPEVVSLLPGYLNDSRR
LGMYVREFIVMISDTAAVAYDVAENECFLAAMSEQVPRNHVSTVSTNNQLYIIGGLFVDE
EDKDAPLQCYFYTLDPLMSEWTALPPMPSPRCLFNIGESNNILFAIAGKDLQSNESLDTV
MCFDVEKMKWSESKKLPLKIHGHSVVSHEGLVYCLGGKTDDKCKALNKMFVYNHKQSEWR
ELAAMKTARAMFGTVIHNGKIIAVGGVNEEGLSSMCETYDFATNKWEPFTDFPQERSSVN
LVSTGGSLYAVGGFAIVQMENKEVAPSEVTDVW
Download sequence
Identical sequences ENSGMOP00000010870 ENSGMOP00000010870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]