SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010895 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010895
Domain Number 1 Region: 207-350
Classification Level Classification E-value
Superfamily PH domain-like 4.18e-40
Family Third domain of FERM 0.00000206
Further Details:      
 
Domain Number 2 Region: 98-206
Classification Level Classification E-value
Superfamily Second domain of FERM 1.01e-36
Family Second domain of FERM 0.00000192
Further Details:      
 
Domain Number 3 Region: 11-95
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.23e-24
Family First domain of FERM 0.0000182
Further Details:      
 
Domain Number 4 Region: 503-595
Classification Level Classification E-value
Superfamily Moesin tail domain 1.96e-16
Family Moesin tail domain 0.0083
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000010895
Domain Number - Region: 441-490
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 0.00327
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010895   Gene: ENSGMOG00000010174   Transcript: ENSGMOT00000011193
Sequence length 595
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_4243:21772:31450:-1 gene:ENSGMOG00000010174 transcript:ENSGMOT00000011193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSILGLKKKQPKTFKVKVITMDAEMEFSCEVKWKGKDLFDLVCRTVGLRETWFFGLRYTV
KDTYAWLKPEKRVLDQEVPKDSPITFSFLAKFFPEKVEEELVQEITQHLFFLQVKKQILD
EEIFCSPEASVLLASYAVQAKYGDYDPNFHKPGFLAQDELLPQRVLMQYQMTAEMWEEKI
TAWYAEHRGIARDEAEMDYLKIAQDLEMYGISYFSITQNKRDTDLLLGVDAQGLHIYSPN
SKLNPNKSFPWSDIRNISYSEKEFTIKPLDKKKDVFKFYSSQLRVNKLILQLCIGNHDLF
MRRRKVDSIEVQQMKAQAKEEKARKKVERQILAREKQMREEAERAKEEMERRLFQLQDEA
RLANEALLRSEETADLLAEKAQIAEEEAKLLAHKAADSEQERQRLEVTAMKTKEEKRMME
QKMREAEQLAVKLVEQSERRLKEADHLKQDLTEAKDAERRAKQKLLEITKTTYPLIAAYS
TPPPPPPPPPPEAAEAGCDAASMRLDFKDSDMKRLSMEIERERLEYMEKSKHLQDQLKEL
KTEIESLKLEEQQQQQASLYSLRGDVRQYAQPHYAQPHSNRNSAYMSQMAFFEEV
Download sequence
Identical sequences ENSGMOP00000010895 ENSGMOP00000010895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]