SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010966 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGMOP00000010966
Domain Number - Region: 20-65
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00905
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010966   Gene: ENSGMOG00000010253   Transcript: ENSGMOT00000011264
Sequence length 71
Comment pep:novel contig::contig379377:221:507:1 gene:ENSGMOG00000010253 transcript:ENSGMOT00000011264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NEDPHHSLMQTAVRMECLGEEFMSSHQVLEAELHSTREELSHLTDKFKRLQDSFCSTRLN
NQLLELQLQSV
Download sequence
Identical sequences ENSGMOP00000010966 ENSGMOP00000010966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]