SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000011465 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000011465
Domain Number 1 Region: 12-186
Classification Level Classification E-value
Superfamily EF-hand 2.42e-28
Family Calmodulin-like 0.000000774
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000011465   Gene: ENSGMOG00000010709   Transcript: ENSGMOT00000011777
Sequence length 188
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_2192:171341:173621:-1 gene:ENSGMOG00000010709 transcript:ENSGMOT00000011777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGATASHLGKDLLSEYQELTFLTKQEILLAHKRFTELLSREDKNLPDPRAPTEAILTLPE
LKSNPFRERIVRVFSTSESRDGLTFEDFLDLLSAFSDSATLEIKSHYAFRIFDFDDDGTL
DENDLEKLVNCLTGETDETRLTPDEMKQLISNILEESDIDKDGTVNLSEFQHVISRSPDF
VSSFKIVL
Download sequence
Identical sequences ENSGMOP00000011465 ENSGMOP00000011465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]