SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000011576 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000011576
Domain Number 1 Region: 294-598
Classification Level Classification E-value
Superfamily Kelch motif 2.75e-43
Family Kelch motif 0.0014
Further Details:      
 
Domain Number 2 Region: 31-146
Classification Level Classification E-value
Superfamily POZ domain 3.88e-30
Family BTB/POZ domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000011576   Gene: ENSGMOG00000010824   Transcript: ENSGMOT00000011891
Sequence length 609
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1628:7193:13280:-1 gene:ENSGMOG00000010824 transcript:ENSGMOT00000011891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSNWNTMMKEGDSFEPCNVIPERRTLLRASESHGLQLLNLVRSFRERGLLFDFTLKAQEH
TFPCHRCVLAACSDFFRAMFEVDMHERNEGSVTLGNQSPRAVGAFLDFAYTGEAVVSDNN
VDMLFQLASFLQVSVLSRACSDFLISTLDISNCLSLSALAEGYGSSSLQQKANFVVQNFQ
SFSLTQDFLEIQVEMLEACLRDNALCVPSEEAVVMSLLRWLDHNLKGRRRLLIGLLSLTR
LHHLPAAVLTALRDTEPLLRGDEACVALLSEALGKQTRYGGLLTDARPATVRSYIYTQKT
EENGQTRHSFCYSLEADRWREVGTGGSPLVPDLPGSHLSSFAEKLFVTGGCRGNCCRAVR
LHVAEPFHDATDEVWCLCPVTGSCTAKAAMSKPRTMHTAVTCLDRVYVIGGRSRGPRGET
PSLLEVEYYDPLSESWTLVSPLPAAIFYPESSTCGSIIYTLGSEVEISDSFNPSLDCFFS
YNAGQDQWSRLVAEFGQFFHAKLIKAVSIHETLHLCDLSTYKVYSFCPETCIWKGEGSFE
CAGFNAGAVGTRDRIYILGGEYSPDEITDDVQVYHSGRSQWEEVAPMPRGLTDFHCQLLS
FNRYRDPWG
Download sequence
Identical sequences ENSGMOP00000011576 ENSGMOP00000011576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]