SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000011997 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000011997
Domain Number 1 Region: 321-512
Classification Level Classification E-value
Superfamily ADP-ribosylation 3.24e-33
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.02
Further Details:      
 
Domain Number 2 Region: 3-79
Classification Level Classification E-value
Superfamily Macro domain-like 0.000000000000589
Family Macro domain 0.0042
Further Details:      
 
Domain Number 3 Region: 230-299
Classification Level Classification E-value
Superfamily WWE domain 0.00000000000432
Family WWE domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000011997   Gene: ENSGMOG00000011217   Transcript: ENSGMOT00000012321
Sequence length 512
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2246:181747:185266:1 gene:ENSGMOG00000011217 transcript:ENSGMOT00000012321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IISSMLKVFKMCEDHKIQSVSFPALSTGAGKLCAVDVGNAMVTAVEGHIKMTKTPSLKDV
HIVIFQANMFQDFRKSLKKCKIVTPTVKRVTAQAKISAPQGGVVAPTQQPSMCLAGACGD
VSFPKVKVEVLGCCSSDLANVKKLVDDLVTKEWKLHHISSPYLALLLPSEKQAIVALSRS
LQVCVSVSAPDKATMSGKEADVLTMVLQIEKDLQKAKERATRQEEEKRLWKTVRWEVCNR
EAWAELDPSVSLDLEHALHKKVPSISYTLQNQTYTVNLDKMERTDRNGTIARIKRTLKAG
SEIAVIEPPTHWDRMDDKTLDIVDLSPSSEQYKRVQANFLQTSKDPNSATFATFTVVKIQ
RIQSKDQWQRYAVKKQMLDKKYPQNKNEMDLYHGTTAEICQKVNSNGFNRSFCGTNATVY
GNGTYFAKQSWYSCNDMYSNPDAQGLKYMYQARVLVAKPCLGTPGMVEPAPLDPSNPYSG
LHDCAVDNVQNPFIYVVFSDAGVYPDYLISFK
Download sequence
Identical sequences ENSGMOP00000011997 ENSGMOP00000011997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]