SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000012092 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000012092
Domain Number 1 Region: 833-1000
Classification Level Classification E-value
Superfamily Macro domain-like 4.04e-39
Family Macro domain 0.0004
Further Details:      
 
Domain Number 2 Region: 615-790
Classification Level Classification E-value
Superfamily Macro domain-like 4.71e-37
Family Macro domain 0.0006
Further Details:      
 
Domain Number 3 Region: 1219-1410
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.94e-33
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.018
Further Details:      
 
Domain Number 4 Region: 397-579
Classification Level Classification E-value
Superfamily Macro domain-like 2.86e-24
Family Macro domain 0.00092
Further Details:      
 
Domain Number 5 Region: 1131-1202
Classification Level Classification E-value
Superfamily WWE domain 0.00000000222
Family WWE domain 0.0058
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000012092
Domain Number - Region: 199-266
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 0.0994
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000012092   Gene: ENSGMOG00000011231   Transcript: ENSGMOT00000012418
Sequence length 1411
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2246:207908:216397:1 gene:ENSGMOG00000011231 transcript:ENSGMOT00000012418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SWESNARREVQTHLEKYIVEHIPMKAEVWQAVKGSCPEVNVATALIAYKICSSELVVVGR
WEEVETLVKEIKSKMEKAIDELKVVINTIEKEIQLDSKERLDLTLDLVRDELGNLDLSKN
NENFTIHLKGLSEKVQTAETRIQEVQDTLTSKKLDSSHNLTQFLQSLDLTKFRNDHFSLD
NIVAVVICGNESVSVLAKKGDIDRAENKLKEVIKQETLSISGEYNKETFGEQWKTFYAEL
KKELESTQNSQNVRIEYSGDKIELCGFRSVVDNVIAKVKGCLENKKVVTEDITLKTLREV
EFVESFMNLPADPQLKALGVTILPCRSPQSPCLKVTATRDHIKEAIGVVNSHIRTITTRE
YMYSKAGEAKILKNNNSLLKMQAKGLSCNLELSEQNITQRFSYDLKGGVTLTLAQGNIAK
QTSDVLICPLVNMSYNNPVAQQFLENGGPEIKNAIDGFEKAKQSLLAGDVIMTNAGTLKS
KKLIYAAIPVWGKSISDLNSTYLVRAVLQSLVKGSNHHCGSLGMPALGCGTFGFPIKDSC
EAIMKGINSFIGLGCGSMETIHLTESDPKTVEGFKSALESLVDPTKTKIPLIPSSTGASH
IVPLPSLQASNTIDLFLIGRVSVILKKADITQENVDVIVNSSNQNLDLNTGSVSGDILKA
AGQSVVDECKKHGNSTSPQAVGNVALTGGGNLNCKHIAHIAGPAKTTASILQVLQAVERV
KNVLKHCEDKNIPSVSFPAIGTGGGGMKFQDSVFALLSGIEAHFSKHKFSALKQIFLVVD
HFKALKECHQVLLSWTQDVGNYAMRLMICSACMITKLLTSADICFFLTIATTAEMLIRPV
KVKLFCGDITKEKTDAIVSSTNTSLNLNTGVSGAILSAAGQTVVDECKILGNQPGDGVVM
TKPGNLAAKHIIHMVGQTKSKDIISSMLKVFKMCEDHKIQSVSFPALGTGVGKLCAVDVG
NAMVTAVEEHIKMKQPSLKDVHIVIFQTTMFQDFRKSLKKSKEGSVAPTQQPSMCLAGAC
GDVSFPKVEVEVLGCCSSDLANVKTLVDDLVTKEWKLHQISSPYLALLLPSEKQAIVALS
RSLQVCVSVSAPDKATVSGKEADVLTMVLQIEKDLQKAKERADRQKEKKRLWKTVRWEVC
DREAWAELAPSVSLDLEHAMDMKERRISYTLQNQTYTVNLDKMERTDRNGTIARIKRTLK
AAVIEPPRNWDRMDKKTLKIVDLSPSSEQYKKVQANFLQTSKVPKTATSATFTVVKIQRI
QSKDQWQRYAVKKQMLEKKYPRNKNEMDLYHGTTAVICQKVNSNGFNRSFCGRNATLYGN
GTYFAKQSWYSCNDTYSNPDAQGLKYMYQARVLVGKPCLGTPGMVEPAPLDPNNPLSGLH
DCAVDNVQNPFIYVVFSDAGAYPDYLISFKA
Download sequence
Identical sequences ENSGMOP00000012092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]