SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000012275 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000012275
Domain Number 1 Region: 314-433,481-572
Classification Level Classification E-value
Superfamily Kelch motif 3.66e-48
Family Kelch motif 0.00021
Further Details:      
 
Domain Number 2 Region: 24-141
Classification Level Classification E-value
Superfamily POZ domain 2.51e-29
Family BTB/POZ domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000012275   Gene: ENSGMOG00000011480   Transcript: ENSGMOT00000012603
Sequence length 572
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_3259:8414:16751:1 gene:ENSGMOG00000011480 transcript:ENSGMOT00000012603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEARQLSPLAGRASPPSSRQTYASSAHYGTVMSGLHDLRQSGILFDVVLLAEGRPIKAH
RILLAAACDYFSRGMFAGGLREAQQTEIAVHGVTYTALSKLLDFIYTSEIELDLDNVQEV
LIAATLVQIGEVISFCCDFLFSWLDESNILEVHKLADMFGLQQLETKIHAYILQNIQTLS
RTAAYRQLPPDKVLRVLSSEELEVLSENEVYEAALHYHYSPEQVETDQVCLQDNLKMLEA
VRFCLMERPVLQRLYGRLDACPLKESVAAALRYHEQEVLQPVLQGPRTQPRSNARXXXXX
XXXXXXXXTSDTEGLFQVFHPSWGEWRTLGAAQAPHMSNQGVAVLNNFVYLVGGDKNTSG
FRAETRCWRYDPRHNSWCSIQPLLQQRADHSVCVLGEHIYAIGGRDYRNELDSVERYDPH
TNTWECVAPLKREXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXHGVAARGGRLYVIGGSNDEHSYRRDVLKVACFDPQSDSWSLVSPLPAGHGEPGLAVL
DARIYVLGGRSHNKGNRMRYVHVYDADLDQWE
Download sequence
Identical sequences ENSGMOP00000012275 ENSGMOP00000012275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]