SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000012342 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000012342
Domain Number 1 Region: 467-763
Classification Level Classification E-value
Superfamily L domain-like 2.79e-39
Family Internalin LRR domain 0.021
Further Details:      
 
Domain Number 2 Region: 31-425
Classification Level Classification E-value
Superfamily L domain-like 1.46e-35
Family Ngr ectodomain-like 0.0062
Further Details:      
 
Domain Number 3 Region: 851-1007
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.18e-30
Family Toll/Interleukin receptor TIR domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000012342   Gene: ENSGMOG00000011526   Transcript: ENSGMOT00000012670
Sequence length 1019
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_888:367813:371481:-1 gene:ENSGMOG00000011526 transcript:ENSGMOT00000012670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LHHNTPLYWFYLVGRLLLFLHQGSLTAMFQHSTNWMSRQFPCDVTGLEFDCEAKKLQEIP
DGITSNATVVNLSKNDLQQIPGNAFSHLENLIELNLYKAKKRGLQNADIKEYAFKNLTKL
LSLDLSNNRLTHIPGDLPPSLTIIRLNNNRFLVLNKDSFAGITNVKNLFLQRNCYFADNC
SKPVNISDNTFAVLTKLEVLDISFNNLRHVPKGLPTTLTNLLLSDNQIHYISEEDFKELH
HLNLLSIHGNCQRCENAAYPCVPCPNISLGIHPKAFTYLNQLKTLHLAGNSLTELNDFWF
ENLKNLTKLLLSFNLLENAIQGELKCFSSLSKLKHLDLSFNFRLKMYPKTVQLSNAFSKL
RSLQVLHLVGLVFREIEFDTLKPLFALKHLTLLNLGTNFIVHCNSTIFKELPQLQNIFLS
ENRLYPVSVSTPNPPGQGGNVEANLISSPQLIAHSLNFGSTLANTECIKAGRVLSFSSNN
LFFITPEQFEGYDNISCLNLSRNGFSSALNGTEFELLPNLTYLDLSFNKIDLAFSNAFQE
LRKLKVLDISFNDHYFKAYGVTHNLDFLKNLPVLEILNMSNNWIHTLTTKMLQSESLNEL
RFVNNELGTLWKDDSYINLFTNLTNLKILDISSNNIAEIPDKVYVLLPWQLTALFINDNK
LSDFNWTKLEHFNNLQTLDLSHNSMTYVRSVTTLTLITLNLSHNKIAQLSDGFIEGAKRL
KTLSLNHNELTVINQTNFLAKPNKDLQTLSLHGNPFQCSCDALDLIIWIEDNNVKIPSLT
TDVYCFVSYGHPQVMIYFDFDQCVNDPLALLISSLTTTFIVVTTSMATVAHIFYWDASYV
LYYLKAKWKGYRSSASPDNVYDVFVTYDTKDPWVSEWVLETLRVKLEVEGEKALPLCLEE
RDWPLGVPLIDNLTQSIRHSRKTLFVLTKAYAKTGVFRLAMYLAHQRLLDENLDVIVVLM
LEPVLQNSHFLRLRRRLCGESVVEWPRTVAAEPWFWQNLRNVVRVDNQTMYTSTYSQYF
Download sequence
Identical sequences ENSGMOP00000012342 ENSGMOP00000012342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]