SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000012471 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000012471
Domain Number 1 Region: 282-541
Classification Level Classification E-value
Superfamily Kelch motif 2.88e-37
Family Kelch motif 0.00035
Further Details:      
 
Domain Number 2 Region: 11-132
Classification Level Classification E-value
Superfamily POZ domain 6.06e-29
Family BTB/POZ domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000012471   Gene: ENSGMOG00000011667   Transcript: ENSGMOT00000012800
Sequence length 600
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1690:53359:55194:-1 gene:ENSGMOG00000011667 transcript:ENSGMOT00000012800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSGPEELEDVDHARGLLKELKSLYDSRLLADIVIGVQGDGSLDIEKLFQCNRNILAAASP
YFKSMFTGGLNESMQDKVVIRGVDAESMSVIIDYCYTGKVTITESNVQKVYGAANMLQLE
YVRLACSSFMTRRLDLSNCVGLLNFADTFGNLELKEKAQTFIAKNFNHLFNGNELCDLDL
THIQEVLGLDTLDVDCERKVCSAALQWIQANAPVETEDALQVLRCVRWNLFAEGDKPYLE
SLMASPLIEKYLAYFVNRSSETYAKSATPKHRIGASAKEMILFFGLPNDNIMCCDPYSED
LYFMAPPLVDLSSQDYKRSTMESLIACATPENNLYLASHLSKHFWLYNPLLNNWQELAER
PLARIHSGMGYLNGHVYILGGRSPVTDVRLKEVECYSVQRNQWTFVAPLPHSLGKMQVVT
LHEHLYVVNRRRMLCYDPRRNRWRNCGSLRRDKLHKACVFQDQIVCVCDIPVVKAYSPSR
GEWKRLGDIPIDSRALNYQVIQHDGKLLLLTQTLLQHNKNRMLIHEYEPARDTWKNVMAV
YVCTLGPVCVATRLYPPCLGSAHSVSMEEEDDSGSSADWDLDGLTDAESDSASSSSFSDE
Download sequence
Identical sequences ENSGMOP00000012471 ENSGMOP00000012471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]